Protein Info for ABZR86_RS03785 in Dyella japonica UNC79MFTsu3.2

Annotation: malonate decarboxylase holo-ACP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF20866: MdcG_N
  • amino acids 18 to 92 (75 residues), 51.2 bits, E=1.1e-17
• TIGR03135: malonate decarboxylase holo-[acyl-carrier-protein] synthase
  • amino acids 18 to 217 (200 residues), 144 bits, E=2.8e-46
• PF10620: MdcG
  • amino acids 108 to 218 (111 residues), 106.3 bits, E=9.7e-35

Predicted SEED Role

"Phosphoribosyl-dephospho-CoA transferase (EC 2.7.7.-)" in subsystem Malonate decarboxylase (EC 2.7.7.-)

KEGG Metabolic Maps

• Biosynthesis of siderophore group nonribosomal peptides
• Lipopolysaccharide biosynthesis
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.-

Use Curated BLAST to search for 2.7.7.-

Sequence Analysis Tools

See A0A1I1Z4W8 at UniProt or InterPro

Protein Sequence (224 amino acids)

>ABZR86_RS03785 malonate decarboxylase holo-ACP synthase (Dyella japonica UNC79MFTsu3.2)
MAASPHAQSARAAADAPRPHDLLWARGVADALHGGSPLPAWADAAWLAVAPMVVRREQAP
PGYVPVGLRGSDRHQRHAAYLAEAAITRRTPPEVLARTRAWEPWGDAAGHACRCALRTLA
PQLDALPWAWGITGGAGFAMSSGLPVLRESSDLDLLLRIPRAPDPAELRQASHLFDGLPL
RADVQIDTGTGGFALAEWLRGGPVLLKTDRGPRLVADPWAIVAP