Protein Info for ABZR86_RS03655 in Dyella japonica UNC79MFTsu3.2

Annotation: glycoside hydrolase family 27 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF02065: Melibiase" amino acids 28 to 124 (97 residues), 31.7 bits, see alignment E=1.3e-11 PF16499: Melibiase_2" amino acids 38 to 311 (274 residues), 253.5 bits, see alignment E=4e-79 PF17801: Melibiase_C" amino acids 325 to 397 (73 residues), 70.8 bits, see alignment E=1.3e-23

Best Hits

Swiss-Prot: 52% identical to AGAL_CYATE: Alpha-galactosidase from Cyamopsis tetragonoloba

KEGG orthology group: K07407, alpha-galactosidase [EC: 3.2.1.22] (inferred from 51% identity to sen:SACE_7065)

Predicted SEED Role

"Alpha-galactosidase precursor (EC 3.2.1.22)" in subsystem Galactosylceramide and Sulfatide metabolism (EC 3.2.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.22

Use Curated BLAST to search for 3.2.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1Z7V4 at UniProt or InterPro

Protein Sequence (400 amino acids)

>ABZR86_RS03655 glycoside hydrolase family 27 protein (Dyella japonica UNC79MFTsu3.2)
MKGMSATLTRLAVCVCATFAVAAYAGDVKPEWSSAAVPQMGFNNWNSTHCRDEFNEDMIR
SVADKMVSTGLRDAGYRHINLDDCWADWQRDKSGNLQPNLKRFPHGIKALADYVHSKGFA
FGLYSSAGTNTCEPHQENRGFPGGLGHEKQDAAFFASVGADYLKYDNCNNEKKPAKERYA
AMGEALRATGRPIFYSLCEWGENKAWLWGADPKVGASSWRTTGDISDKYDSMLKIFKQNV
VLDAYAGPGHWNDPDMLEVGNGGMTDVEYRSHFSLWSIMAAPLLIGTDLRKISPSALEIL
LNKEVIAVDQDPLGKQGKQVRDAKGIHVIVKPMKDGSQAVAVFNEGDAAQDVTVSAQELG
LKAGKYRMRDLWKHADTQGDGSIKLKLEPHATVMYRISAM