Protein Info for ABZR86_RS03555 in Dyella japonica UNC79MFTsu3.2

Annotation: molybdenum cofactor biosynthesis protein MoaE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 PF02391: MoaE" amino acids 13 to 124 (112 residues), 92.1 bits, see alignment E=1.4e-30

Best Hits

KEGG orthology group: K03635, molybdopterin synthase catalytic subunit [EC: 2.-.-.-] (inferred from 63% identity to sml:Smlt2778)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaE" in subsystem Molybdenum cofactor biosynthesis

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1ZAG7 at UniProt or InterPro

Protein Sequence (167 amino acids)

>ABZR86_RS03555 molybdenum cofactor biosynthesis protein MoaE (Dyella japonica UNC79MFTsu3.2)
MDDLHVAVVERADAALDVAAALDFVSDPRFGGISVFVGKVRDFNLGRQVVGISYDLFVPL
ALRTFRNIGERARAEIGAPMKLYIAHAKGDLGLGDLAVVVAAGTPHRAEAFRACRLAIEA
VKHEAPIWKQEHYVDGDSAWSEGCSLCEQPSEGAQDHSGHDGHGHAH