Protein Info for ABZR86_RS03535 in Dyella japonica UNC79MFTsu3.2

Annotation: GTP 3',8-cyclase MoaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 4 to 314 (311 residues), 321.5 bits, see alignment E=2.9e-100 PF04055: Radical_SAM" amino acids 18 to 178 (161 residues), 98.8 bits, see alignment E=4.1e-32 PF06463: Mob_synth_C" amino acids 186 to 310 (125 residues), 117.4 bits, see alignment E=4.2e-38

Best Hits

Swiss-Prot: 63% identical to MOAA_STRM5: GTP 3',8-cyclase (moaA) from Stenotrophomonas maltophilia (strain R551-3)

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 63% identity to smt:Smal_2244)

MetaCyc: 50% identical to GTP 3',8'-cyclase (Escherichia coli K-12 substr. MG1655)
RXN-8340 [EC: 4.1.99.22]

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.99.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1ZF07 at UniProt or InterPro

Protein Sequence (327 amino acids)

>ABZR86_RS03535 GTP 3',8-cyclase MoaA (Dyella japonica UNC79MFTsu3.2)
MNVLSDRYGRHFPYLRLSIVPACNFRCTYCLPNGYHANPHAAAPLNLAEIARLLRGFAAV
GMHKLRITGGEPSVRHDLSDILRTAAGIPGVRKLAMTTNGTLLSRRLGEWMDAGLNAINV
SVDSLDRASFARITGHDRLDDILAGIDMALAAGLASVKLNAVLLRDVNDRELPAWLDYLR
DRPVGLRFIELMQTGDSLAFFREHHVRAETLETQLQEAGWEALPRAADAGPAREYRHADY
AGRIGIIAPYSKDFCAGCNRLRVTATGDLRLCLFGEFGIPLRPLLQDDNQLEDLVRAIGG
QLVRKEQTHHLHEGRTGITPHLASTGG