Protein Info for ABZR86_RS03510 in Dyella japonica UNC79MFTsu3.2

Annotation: XdhC/CoxI family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 PF02625: XdhC_CoxI" amino acids 20 to 85 (66 residues), 68.2 bits, see alignment E=4.7e-23 PF13478: XdhC_C" amino acids 209 to 343 (135 residues), 92.2 bits, see alignment E=3.6e-30

Best Hits

Predicted SEED Role

"Xanthine and CO dehydrogenases maturation factor, XdhC/CoxF family" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1ZBP9 at UniProt or InterPro

Protein Sequence (364 amino acids)

>ABZR86_RS03510 XdhC/CoxI family protein (Dyella japonica UNC79MFTsu3.2)
MNASQEFPQLFAAVQQLRARSAPEPAALATIVRTSGSTFRRAGARMLVHADGTVTCALAG
GCPQRDIVLRAQRAMAERTPALVPYNRESNLDLLMEVGCGGELDVLIEPLVQPADFHFLD
VLARLHEERAPASVATVFSRDGEVHTPRPWRLIRHAAGHWTDIPAQGLAQRIHALADVAE
AGGAVLERAEADGAQLDVLLEAWRPKPALVVVGYSECALALSRLAHGLGWQTTLVEHVAV
ARERLNGVGAQLHAAPEMLPEQLPFDRQTAVVVMTHHYERDLAYVQALAPLPLAYLGVIG
SRERAGRIRDAVPVSATAIHAPAGLDIGSETAQEIALSVAAEIMAAMRARSGARLSRIEG
PIHS