Protein Info for ABZR86_RS03505 in Dyella japonica UNC79MFTsu3.2

Annotation: aldolase/citrate lyase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03328: HpcH_HpaI
  • amino acids 13 to 217 (205 residues), 102.6 bits, E=9.8e-34

Best Hits

KEGG orthology group: K02510, 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase [EC: 4.1.2.-] (inferred from 70% identity to xal:XALc_0724)

Predicted SEED Role

"2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase (EC 4.1.2.n4)" (EC 4.1.2.n4)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Lysine degradation
• Naphthalene and anthracene degradation
• Pentose phosphate pathway
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Tyrosine metabolism
• alpha-Linolenic acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.- or 4.1.2.n4

Sequence Analysis Tools

See A0A1I1ZCW6 at UniProt or InterPro

Protein Sequence (242 amino acids)

>ABZR86_RS03505 aldolase/citrate lyase family protein (Dyella japonica UNC79MFTsu3.2)
MPRSIGLLQSVPSPLLCEMLGHAGYDFVLLDLEHVLLSPDQLQHAIRACELGGCAPWVRV
PEVDEKLIGRVLDAGARGVVISRLETVEQAERAVAAARFPPLGRRGITGGRVTGFGKTAL
PDYIEQANREIHVVPMIESEAGVRALPQILAVPGISLVMEGALDLALDLGLGPQPLHADV
WQRLQDIADCCDTAGIPFCPNPRNEQQLRYWAAREVRWMLAGEDRGLLLAALRDRAAALR
AS