Protein Info for ABZR86_RS03500 in Dyella japonica UNC79MFTsu3.2

Annotation: TonB-dependent siderophore receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 689 signal peptide" amino acids 1 to 13 (13 residues), see Phobius details PF07715: Plug" amino acids 43 to 153 (111 residues), 74.6 bits, see alignment E=1.3e-24 TIGR01783: TonB-dependent siderophore receptor" amino acids 45 to 689 (645 residues), 276.6 bits, see alignment E=2.4e-86 PF00593: TonB_dep_Rec" amino acids 238 to 656 (419 residues), 144.4 bits, see alignment E=1.6e-45 PF14905: OMP_b-brl_3" amino acids 360 to 668 (309 residues), 31.3 bits, see alignment E=1.8e-11

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 71% identity to xcb:XC_1108)

Predicted SEED Role

"Vibrioferrin receptor PvuA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1ZCA4 at UniProt or InterPro

Protein Sequence (689 amino acids)

>ABZR86_RS03500 TonB-dependent siderophore receptor (Dyella japonica UNC79MFTsu3.2)
MACALCAATAHADDTTAPNKPRELEAVQVQGNVLGSSSKENVRTYAGSRKVIGSEDLANG
ANRSLDDALQQVPGIKIFDETGTGVLPQIMLRGLYESRSGRVQVLEDGIPLSLAPYGQTS
LSLFPVTMNQIDRIDIVRGGAAVQYGPNNVGGVINLVSKPIPERWTTTLGEKITAGGAGR
YLRDTTLSTGGYLTPDFGLQVDADWNKGQYWREHSGTDVKNLRLRAEWWLADDKLLKAQV
QRYVANMDMAGALSVADYEENPRQATRPLDRFTGRTTRASLTWQQDLGAWGPFDQSQFTW
TNFSADSSRNFIVGMRRLATETWRPDLAPQLLQSAPRGFKVYGSEPRIALHVDSGNVTQQ
WTAGVRAVREDIDFLVGNTGLDNGVYTLVRNWQFKDRAWSAYVSDAIGLFNDRLTVTPGL
RYEHLNSTYLNRANGISTQNNVRNALPGLTVGYKASSQWYVYADAQRSLRAPQVTQIIYG
DNLDSELAWNYEAGARYMPVEGTSINLDVYRIDFDKQIQLDNTTRTYANLGKTRHQGAEL
ELEWSPPSLRALKLSAGYAYLDASQQSGQYAGRRVPYTSRNQLNLGASYSRGDTVVALTS
YYFSKAYSDAANTVRENAIASVGQLPSYWVWNMQFTQMLMRAGSSTLKGTLAVNNLFDRR
YWYRGIDTSPWGRQAAPGRTVTAGVELAF