Protein Info for ABZR86_RS03475 in Dyella japonica UNC79MFTsu3.2

Annotation: type III PLP-dependent enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 PF00278: Orn_DAP_Arg_deC" amino acids 28 to 372 (345 residues), 56.7 bits, see alignment E=3.6e-19 PF01168: Ala_racemase_N" amino acids 31 to 217 (187 residues), 48 bits, see alignment E=2e-16 PF02784: Orn_Arg_deC_N" amino acids 33 to 278 (246 residues), 93.1 bits, see alignment E=2.8e-30

Best Hits

KEGG orthology group: K01586, diaminopimelate decarboxylase [EC: 4.1.1.20] (inferred from 70% identity to xac:XAC3181)

Predicted SEED Role

"Vibrioferrin decarboxylase protein PvsE"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.20

Use Curated BLAST to search for 4.1.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1ZC53 at UniProt or InterPro

Protein Sequence (431 amino acids)

>ABZR86_RS03475 type III PLP-dependent enzyme (Dyella japonica UNC79MFTsu3.2)
MTLHCSPEPVEALLARWRIESREPICAYVYDLDALQRHVRWMREALPHGCELYYAAKANP
EAPVLRTLAPWVDGFEAASGGELRWLHEQQPAHPLLFGGPGKLDSELVLAAALPDCTLHV
ESLGELARLAAIADGLDRNVPVFLRMNIAVPGIGDTRLMMGGKPTPFGMDEQDLPQAVAM
LREHPRLRLEGFHFHLMSHQRDARMQLDLVRAYLDVANRWKAAYGLDFAVVNAGGGFGVD
YADPSASFDWLGFCTGLRGVLDRHANGLRLRFEPGRYVSVACGWYAMEVLDIKRNHGEWF
AVARGGTHHFRTPPAQGHDHPFRILRGNHAPLIEHERVTLVGQLCTPKDVLARAQPVEAL
APGDCLLFPLAGAYAWNISHQNFLMHPAPRMAFLQAESMAEEVCYVRAGGPNQLGRTAAS
PSSLPSPTQAT