Protein Info for ABZR86_RS03205 in Dyella japonica UNC79MFTsu3.2

Annotation: ROK family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 PF12802: MarR_2" amino acids 28 to 81 (54 residues), 36.7 bits, see alignment 5.6e-13 PF13412: HTH_24" amino acids 28 to 71 (44 residues), 22.8 bits, see alignment 8e-09 PF00480: ROK" amino acids 98 to 379 (282 residues), 65.8 bits, see alignment E=7.4e-22

Best Hits

Predicted SEED Role

"N-acetylglucosamine-6P-responsive transcriptional repressor NagC, ROK family" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1ZIY6 at UniProt or InterPro

Protein Sequence (387 amino acids)

>ABZR86_RS03205 ROK family transcriptional regulator (Dyella japonica UNC79MFTsu3.2)
MAAPTPFARQLHPAFLRDVDSGAAVSSNERDLLDLVRRHGTTTRADLVRATGLTAQSVMR
LVDELVERGMLELGETRSQGRGKPAATVTLVPDYAHAIGVSITTDSIALGLMDFAGNLLG
QHQEPMRATGRGALLRRIRTLAERLLHKSEVDEDSVFGVGLGMTGFFIGEGSKVNPPEPL
DGLALLEVDTLLADAMGHPVWLDNDGSVAAIGESLHGVGHRYRDFAYFYFGHGFGGGLIM
DGRCSRGAHGNAGEFAGMLPALGLERAALETLRSMLVKDGEDLPDIQALVEQYDPAWPAI
ERWIERVAPGLSVIASAVVAIVDPQAIVLGGRIPPDLAQRLIPRIAIDNVSRRGHARPQP
AIVTAQAPFDAVALGAASLPFKECFFH