Protein Info for ABZR86_RS03000 in Dyella japonica UNC79MFTsu3.2

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 transmembrane" amino acids 308 to 328 (21 residues), see Phobius details PF00106: adh_short" amino acids 94 to 280 (187 residues), 176.5 bits, see alignment E=8.9e-56 PF08659: KR" amino acids 94 to 257 (164 residues), 53.4 bits, see alignment E=6.2e-18 PF01370: Epimerase" amino acids 95 to 227 (133 residues), 27.8 bits, see alignment E=3.3e-10 PF13561: adh_short_C2" amino acids 100 to 331 (232 residues), 205.6 bits, see alignment E=1.7e-64

Best Hits

Swiss-Prot: 55% identical to GS39_BACSU: General stress protein 39 (ydaD) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 64% identity to bbr:BB2846)

MetaCyc: 41% identical to NADP+-dependent aldehyde reductase (Escherichia coli K-12 substr. MG1655)
1.1.1.-

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1ZP56 at UniProt or InterPro

Protein Sequence (334 amino acids)

>ABZR86_RS03000 SDR family oxidoreductase (Dyella japonica UNC79MFTsu3.2)
MAVRTRSKATAAADRQRAVQREIDEKDSAKAKSGKSAAAEKSAKPKQATARKQPETPLPE
QHQAKPGKEHQLQPRPHFKAPQYKGSDKLKGMATLITGGDSGIGRAVAVLFAREGADVGI
VYLESSDDAEETRRHVEQEGGRCLLIQGDVTDPDFCQQAVEETVEEFGHLDVLVNNAAFQ
EHADTLEDITEEHMDLTFRTNLYGYFHMARAALPHMKAGASIINTGSETGLFGNPKLLDY
SATKGAIHAFTRSLSANLVKKGIRVNAVAPGPVWTPLNPADQPAKSVAKFGSSNPMGRPA
QPEEVAPAYVFLAAPSCASYISGAILPVMGGPTG