Protein Info for ABZR86_RS02985 in Dyella japonica UNC79MFTsu3.2

Annotation: alpha/beta fold hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 PF02129: Peptidase_S15" amino acids 17 to 122 (106 residues), 23.2 bits, see alignment E=2e-08 PF01738: DLH" amino acids 23 to 123 (101 residues), 26 bits, see alignment E=2.6e-09 PF00561: Abhydrolase_1" amino acids 29 to 123 (95 residues), 28.8 bits, see alignment E=4e-10 PF12146: Hydrolase_4" amino acids 30 to 150 (121 residues), 34.8 bits, see alignment E=4.4e-12 PF12697: Abhydrolase_6" amino acids 31 to 222 (192 residues), 36.8 bits, see alignment E=2.7e-12 PF00326: Peptidase_S9" amino acids 50 to 241 (192 residues), 45.2 bits, see alignment E=3.4e-15 PF05728: UPF0227" amino acids 100 to 222 (123 residues), 25.3 bits, see alignment E=5.5e-09

Best Hits

KEGG orthology group: K06889, (no description) (inferred from 60% identity to reu:Reut_B5068)

Predicted SEED Role

"Prolyl oligopeptidase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1ZSG1 at UniProt or InterPro

Protein Sequence (271 amino acids)

>ABZR86_RS02985 alpha/beta fold hydrolase (Dyella japonica UNC79MFTsu3.2)
MPVRDDVIHISMRGRELAGTLISPAPRMPAVLMVHGWGGSQRQYRANAHKVAALGCVCLT
FDLTGHVATASQRDTVSREENLHDMLAAYDFLAAHPLVERDSIAVVGSSYGGYLAALLTE
RRPVCWLGLRAPAIYRDDDWSVPKRLLARVQKLGDYRGQPIEANDNRALRACSRFTGDVL
IVESEHDEIVPSPVLASYRKACTETHSLTYRVIRGADHSLSDEASREAYSSILVHWLEEM
MLGARGQVRAAAAKVRGSDKQETPLRRAGQS