Protein Info for ABZR86_RS02895 in Dyella japonica UNC79MFTsu3.2

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 TIGR00968: sulfate ABC transporter, ATP-binding protein" amino acids 4 to 242 (239 residues), 349.7 bits, see alignment E=3.8e-109 PF00005: ABC_tran" amino acids 18 to 164 (147 residues), 129.9 bits, see alignment E=1.6e-41 PF08402: TOBE_2" amino acids 276 to 342 (67 residues), 22.3 bits, see alignment E=1.7e-08

Best Hits

Swiss-Prot: 51% identical to CYSA1_CHRVO: Sulfate/thiosulfate import ATP-binding protein CysA 1 (cysA1) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

KEGG orthology group: K02045, sulfate transport system ATP-binding protein [EC: 3.6.3.25] (inferred from 51% identity to cvi:CV_1828)

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1ZRM6 at UniProt or InterPro

Protein Sequence (384 amino acids)

>ABZR86_RS02895 ABC transporter ATP-binding protein (Dyella japonica UNC79MFTsu3.2)
MSLSIRQLTRRYGAFAALDDFSLDIAEGEFVALLGPSGSGKSSLLRILAGLDDPDRGDVL
RDGTDLLALPAQRRDIGLVFQHYALFPHMTVADNIAFGLRVRPRARRPSRRDIAARVEDL
LRRVQLEELGRRYPTQLSGGQRQRVALARALAVEPSLLLLDEPFGALDAQVRGTLRVWLR
DLQRSLGLTTVLVTHDQDEALELADRVVVMNRGRIEQVGAPSEIYREPATPFVHGFVGRA
NRIRGHVERDRLHLGGHSFQGELPGDLAGREIEAWLRPEHLALASRGLGGWTGRLQHLDL
AGPVARARLAMHGDGLVLDAEWNAAEVAAHGLAIGEVVTLQPREFTLFADVPGGVRRLRF
VPAPAGPHADSHPIDFAAWLHRKA