Protein Info for ABZR86_RS02890 in Dyella japonica UNC79MFTsu3.2

Annotation: sulfate ABC transporter permease subunit CysW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 23 to 46 (24 residues), see Phobius details amino acids 70 to 94 (25 residues), see Phobius details amino acids 106 to 131 (26 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details amino acids 205 to 228 (24 residues), see Phobius details amino acids 253 to 274 (22 residues), see Phobius details TIGR00969: sulfate ABC transporter, permease protein" amino acids 22 to 281 (260 residues), 315.6 bits, see alignment E=2.9e-98 TIGR02140: sulfate ABC transporter, permease protein CysW" amino acids 23 to 282 (260 residues), 372.7 bits, see alignment E=1e-115 PF00528: BPD_transp_1" amino acids 84 to 277 (194 residues), 43.1 bits, see alignment E=2e-15

Best Hits

Swiss-Prot: 49% identical to CYSW_ECOL6: Sulfate transport system permease protein CysW (cysW) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02047, sulfate transport system permease protein (inferred from 65% identity to rce:RC1_3866)

MetaCyc: 49% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysW (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysW" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1ZSM1 at UniProt or InterPro

Protein Sequence (297 amino acids)

>ABZR86_RS02890 sulfate ABC transporter permease subunit CysW (Dyella japonica UNC79MFTsu3.2)
MAAVAAYAANTARRSRSGRWRHALLIALALLCVGVLLVLPLLAVFAEAFAKGWAVFAAAV
TDPDALAAVRLTLTVAAIAVPANTVFGLAAAWLLTHHQFRGKALLGALIDLPFSVSPVVA
GLVCVLVYGVHGWFGGWLEAHGLRVIFAWPGLVLATVFVAFPFVARELIPLMQAQGSDEE
LAARTLGAGGWQIFFRVTLPRIRWALLYGVLLCTARSMGEFGAVSVVSGHLPGLTNTLPL
QVDQVYNGGSDTAIASAFALASLLACLGLVTLLAKRLMEWRHGGELAHSLRRSEPSA