Protein Info for ABZR86_RS02885 in Dyella japonica UNC79MFTsu3.2

Annotation: sulfate ABC transporter permease subunit CysT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 56 to 82 (27 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details TIGR02139: sulfate ABC transporter, permease protein CysT" amino acids 6 to 269 (264 residues), 364.4 bits, see alignment E=4e-113 TIGR00969: sulfate ABC transporter, permease protein" amino acids 8 to 264 (257 residues), 292.1 bits, see alignment E=4.4e-91 PF00528: BPD_transp_1" amino acids 71 to 264 (194 residues), 79.7 bits, see alignment E=1.2e-26

Best Hits

Swiss-Prot: 46% identical to CYST_SYNY3: Sulfate transport system permease protein CysT (cysT) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02046, sulfate transport system permease protein (inferred from 64% identity to msv:Mesil_3314)

MetaCyc: 46% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysU (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysT" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1ZRV3 at UniProt or InterPro

Protein Sequence (274 amino acids)

>ABZR86_RS02885 sulfate ABC transporter permease subunit CysT (Dyella japonica UNC79MFTsu3.2)
MSRRALPGFGLSLGITLAWLGGIVLLPLTALAWKAASLGPSAWWAHLGTRRVLLALQLSF
GGALVAAVLDLLLGLLLAWVLVRYRFPLRRVCDALIDLPFALPTAVAGIALTALYAPNGW
VGQLLQPLGVQVAYTRLGVLLAMVFVGLPFVVRTLQPVIESLEREVEEAALTLGASPWQS
FRRVLLPLLAPTLLTGFALALARAVGEYGSVIYISGNLPLRTEIVPLLIVQKIDAGDDTA
PAALLGAVMLAVSLLVLLTVNGLQRWSRRWSGVS