Protein Info for ABZR86_RS02870 in Dyella japonica UNC79MFTsu3.2

Annotation: YadA-like family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 950 992 signal peptide" amino acids 1 to 49 (49 residues), see Phobius details transmembrane" amino acids 921 to 936 (16 residues), see Phobius details PF05658: YadA_head" amino acids 119 to 140 (22 residues), 12.9 bits, see alignment (E = 1.7e-05) amino acids 146 to 168 (23 residues), 13.3 bits, see alignment (E = 1.4e-05) amino acids 291 to 317 (27 residues), 21.8 bits, see alignment (E = 2.9e-08) amino acids 348 to 374 (27 residues), 19 bits, see alignment (E = 2.2e-07) amino acids 377 to 402 (26 residues), 11.3 bits, see alignment (E = 5.7e-05) amino acids 404 to 430 (27 residues), 17.9 bits, see alignment (E = 4.7e-07) amino acids 432 to 457 (26 residues), 16.3 bits, see alignment (E = 1.5e-06) amino acids 460 to 486 (27 residues), 30.4 bits, see alignment (E = 5.6e-11) amino acids 498 to 512 (15 residues), 10.3 bits, see alignment (E = 0.00012) amino acids 501 to 527 (27 residues), 12.6 bits, see alignment (E = 2.2e-05) amino acids 568 to 587 (20 residues), 13.1 bits, see alignment (E = 1.5e-05) amino acids 605 to 631 (27 residues), 22.6 bits, see alignment (E = 1.6e-08) PF05662: YadA_stalk" amino acids 216 to 245 (30 residues), 30.6 bits, see alignment (E = 5.6e-11) amino acids 663 to 688 (26 residues), 35.3 bits, see alignment (E = 1.9e-12) PF03895: YadA_anchor" amino acids 940 to 992 (53 residues), 26.8 bits, see alignment 6.7e-10

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1ZVI1 at UniProt or InterPro

Protein Sequence (992 amino acids)

>ABZR86_RS02870 YadA-like family protein (Dyella japonica UNC79MFTsu3.2)
MRIHSKTWNGSLPVVPFGHGRGGPRRPRLRLAAPLLAAGSLLAGGVSADESGPVATFPAA
AASVGVPRTAAEVAADGSHADGGAVAGGRDASAVGNGAQASSHGTSAFGGHARADKLAAS
AFGSNARAAAAHATAVGANAQALAATATALGANAQARANTAIAVGFEAKVREGATNGATF
GVRSEVLAPDAVALGAGSVADRAGTVSVGRAGAARQIVQVAAGSAATDAVNKAQLDALSS
EVGDAAHYFKAAGMHDGSDDARADHSGAIAAGRDSHARAGGATAVGAASVAGGYDSTALG
HAAQALADASTAIGSGAQAYGFGNTALGVHATADGEDSATALGMLSAASGTGATALGAVA
DASGKESLALGFFAESSGEESLAAGTYSMASGAFAIAAGSDAYAQGDEAMAIGRLSHAAG
VASLAIGASSLAAGAQSIALGRDAQAGRDYGTAVGAASYAQGLGATALGQGATAFGDQSM
ALGYGSAALGAGDLSVGASTARGQFSVAIGTGNVVDTFHATAIGSSSRIERDSWNSVALG
HEAAILGDAPGAIAIGTGTRVGTHALGGLALGFLAQVEGARSIAIGGPAQVDGGDGSSVY
RSAAAKGAFATALGSAALAEADRATALGFGAYVSATGAIALGARSIADRPDTVSVGRSGY
DRQIAHVAAGTEATDAVNVQQLHQLIESGGATGRAVQYDATSRDRITLKGAEGTVLGNLK
AGAITAGSREAVRGGQLFEHGDQMAQMFGGGTTMTRFGLSGPVYAIQGSHFYSVGDAFSA
VDGKLGELDFRVNRLEEGDSAQGRLVVRLRSVAASTSPQQEQVAALARQSPPSPASAPAS
MGHRAGGAAPADAVSTSQVQEAVVTARQYADEAIRQASSEARAYTDQRVAALVANADFDV
FKSDVTGRFRSLSTRLHRVGAMGTALAGMAGAVAAAAGTGSRISAAVGGYRGQGALALGF
AQRIPGNGAVLLGGSLAGGGESSGTLGVSFGW