Protein Info for ABZR86_RS02800 in Dyella japonica UNC79MFTsu3.2

Annotation: single-stranded-DNA-specific exonuclease RecJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 572 transmembrane" amino acids 184 to 202 (19 residues), see Phobius details TIGR00644: single-stranded-DNA-specific exonuclease RecJ" amino acids 24 to 566 (543 residues), 457 bits, see alignment E=3.7e-141 PF01368: DHH" amino acids 74 to 231 (158 residues), 82.7 bits, see alignment E=4e-27 PF02272: DHHA1" amino acids 354 to 451 (98 residues), 60.2 bits, see alignment E=3.6e-20 PF17768: RecJ_OB" amino acids 466 to 568 (103 residues), 73.7 bits, see alignment E=1.8e-24

Best Hits

Swiss-Prot: 52% identical to RECJ_DICD3: Single-stranded-DNA-specific exonuclease RecJ (recJ) from Dickeya dadantii (strain 3937)

KEGG orthology group: K07462, single-stranded-DNA-specific exonuclease [EC: 3.1.-.-] (inferred from 56% identity to xal:XALc_1342)

Predicted SEED Role

"Single-stranded-DNA-specific exonuclease RecJ (EC 3.1.-.-)" in subsystem DNA-replication or DNA Repair Base Excision or DNA repair, bacterial RecFOR pathway (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1ZTQ6 at UniProt or InterPro

Protein Sequence (572 amino acids)

>ABZR86_RS02800 single-stranded-DNA-specific exonuclease RecJ (Dyella japonica UNC79MFTsu3.2)
MSPRLDLRRRLPKGEPQGWSDAVHPVLRQIYAARGVLGPADADHRLACMLAPHQLGGMER
AVELLIEAIRGDWRILIAGDYDCDGATGTAVAVRGLRMLGARQVDYAVPNRFIHGYGLSP
ALVESLQPRPQLIITVDNGVASVSGVATAQALGIRVIVTDHHLPGEQLPAADAMVNPNLA
GDAFPSKALAGVGVMFYLLLALRSTLRGQGAFAEGKEPDLSVLLDLVALGTVADLVPLDY
NNRVLVEAGLKRIRAGRACPGIAALVDAGKRSVATLCASDLGFSVGPRLNAAGRLEDMRL
GVECLLTDIPAVARRYAEQLSAINQERRELQATMVAEAEVMVARAADIDAVGVALFEPSW
HAGVVGLVASKLKERLHRPAIAFAPASEDNTGELRGSGRSIAGFHIRDALAAIDARQPGL
IERFGGHAMAAGLSLKADDFARFAAAFDAIARDWLDEACLEHVLYTDGELPPGAATLELA
RQLRYGGPWGQAFPEPVFENEFACASWRVMGETHLRLSLSDPRDGAVLDAVMFGGYTGQP
PPSRLRAAYELTINDWQGRESPRLLLRHIEPL