Protein Info for ABZR86_RS02735 in Dyella japonica UNC79MFTsu3.2

Annotation: 4a-hydroxytetrahydrobiopterin dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01329: Pterin_4a
  • amino acids 21 to 109 (89 residues), 100.5 bits, E=2.4e-33

Best Hits

Swiss-Prot: 51% identical to PHS_XANOR: Putative pterin-4-alpha-carbinolamine dehydratase (XOO3067) from Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)

KEGG orthology group: K01724, 4a-hydroxytetrahydrobiopterin dehydratase [EC: 4.2.1.96] (inferred from 55% identity to psu:Psesu_1707)

Predicted SEED Role

"Pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96)" in subsystem Pterin biosynthesis (EC 4.2.1.96)

MetaCyc Pathways

• L-phenylalanine degradation V (2/3 steps found)
• tetrahydropteridine recycling (1/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.96

Sequence Analysis Tools

See A0A1I1ZVV0 at UniProt or InterPro

Protein Sequence (113 amino acids)

>ABZR86_RS02735 4a-hydroxytetrahydrobiopterin dehydratase (Dyella japonica UNC79MFTsu3.2)
MSQADLASQHCTPRKGKEHALDGVQIETLLARLPGWRVAAEGKAIVKDFKFADFHHTLGF
INAVGFMANQEDHHPDLEAGYGHCQVLWSTHDVGGLSLNDFICAARVEALLAR