Protein Info for ABZR86_RS02730 in Dyella japonica UNC79MFTsu3.2

Annotation: CPBP family intramembrane glutamic endopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 282 to 300 (19 residues), see Phobius details amino acids 307 to 324 (18 residues), see Phobius details amino acids 330 to 347 (18 residues), see Phobius details amino acids 367 to 390 (24 residues), see Phobius details amino acids 396 to 415 (20 residues), see Phobius details amino acids 422 to 439 (18 residues), see Phobius details amino acids 445 to 462 (18 residues), see Phobius details amino acids 469 to 491 (23 residues), see Phobius details PF02517: Rce1-like" amino acids 408 to 478 (71 residues), 36.4 bits, see alignment E=2.6e-13

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I1ZVK5 at UniProt or InterPro

Protein Sequence (501 amino acids)

>ABZR86_RS02730 CPBP family intramembrane glutamic endopeptidase (Dyella japonica UNC79MFTsu3.2)
MGARLLPAVRAAGFVLAAALLLLGLRALAGWMVENHLRHEAGRELHALQAGQPLWRWSLR
QPRDLVAGRAFGNATVRGGATGLKVSSRDGKTFELGLPVMRPMDLAHWPQLWLVMRVSKA
AQLSLVVQPQAQAPACVAQTDAIPAGDAATFVFDLRKLDWRHADSSACALPATVAYLFRL
RVQLPAGETLELREASLVAERPVRLPGAAPTVDLSAGREIDLLEQVTAAPTMPAVPLVWL
PRDGSVETWLQLRDRLHGLWPAAIVVPAGTVLTPMADDTGPAWVGWAVCAAYLLLMLYAA
RREIHPAWDVLLVAAGPLWLIAGLQWGLHASAPAATAFVAALVWAAWREIRQRPADWHWL
GGKTTDWLAPLALLPVAGGLPILLGHGFAAPEWRHAFLYVGWAGLQQWLMLAVVLRRLQR
WPGGSALPILGAATLFALLHVPNGALMQLCFLAELWWAWCFLRSRRLLPIALAHAGCALL
VESGLSGAVLRSLEVSARFFL