Protein Info for ABZR86_RS02225 in Dyella japonica UNC79MFTsu3.2

Annotation: prephenate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01807: chorismate mutase
  • amino acids 8 to 83 (76 residues), 86 bits, E=8.3e-29
• PF01817: CM_2
  • amino acids 12 to 90 (79 residues), 63.3 bits, E=3.4e-21
• PF00800: PDT
  • amino acids 95 to 269 (175 residues), 209.6 bits, E=5.2e-66
• PF01842: ACT
  • amino acids 280 to 343 (64 residues), 43.3 bits, E=3.7e-15

Best Hits

Swiss-Prot: 52% identical to CMPDT_PSEST: Bifunctional chorismate mutase/prephenate dehydratase (pheA) from Pseudomonas stutzeri

KEGG orthology group: K14170, chorismate mutase / prephenate dehydratase [EC: 4.2.1.51 5.4.99.5] (inferred from 68% identity to sml:Smlt3097)

Predicted SEED Role

"Chorismate mutase I (EC 5.4.99.5) / Prephenate dehydratase (EC 4.2.1.51)" in subsystem Chorismate Synthesis or Phenylalanine and Tyrosine Branches from Chorismate (EC 4.2.1.51, EC 5.4.99.5)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (17/18 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (9/10 steps found)
• L-phenylalanine biosynthesis I (3/3 steps found)
• L-phenylalanine biosynthesis III (cytosolic, plants) (2/2 steps found)
• L-tyrosine biosynthesis I (2/3 steps found)
• L-phenylalanine biosynthesis II (1/4 steps found)
• L-tyrosine biosynthesis II (1/4 steps found)
• L-tyrosine biosynthesis III (1/4 steps found)
• superpathway of L-phenylalanine and L-tyrosine biosynthesis (1/5 steps found)
• superpathway of chorismate metabolism (38/59 steps found)
• bacilysin biosynthesis (1/10 steps found)
• salinosporamide A biosynthesis (3/15 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.51 or 5.4.99.5

Sequence Analysis Tools

See A0A1I2A558 at UniProt or InterPro

Protein Sequence (362 amino acids)

>ABZR86_RS02225 prephenate dehydratase (Dyella japonica UNC79MFTsu3.2)
MTEPKASLEQVRERIDSIDRQIQELISERAGWAQEVARVKGAGLSAIDYYRPEREAHVLR
MVVDRNRGPLSDTEMVRLFREIMSSCLAQEDPLKVGFLGPEGTFSEQAVRKHFGHAAYGL
PLGSIEEVFQEVAAGHADFGVVPVENSGQGMIQITLDMFLTSEATICGEIELRVHQCLHS
QGGRMEDIKRVYAHAQSLQQCKTWLRINLPDVECIAVSSNAEAARMARHADDAAAIAGET
AGRVYGLKTLATGIEDRADNTTRFLVIGRSLFPPSGNDRTSLLITVNDKPGALYDVLSPF
AKHDVSLNRIESRPAHTGKWQYAFFIDVSGHVQDAPIQAAMQEMGGAAAQVRVLGSYPVA
LP