Protein Info for ABZR86_RS02185 in Dyella japonica UNC79MFTsu3.2

Annotation: tRNA 2-thiouridine(34) synthase MnmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF03054: tRNA_Me_trans" amino acids 1 to 196 (196 residues), 258.3 bits, see alignment E=9.7e-81 TIGR00420: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase" amino acids 1 to 353 (353 residues), 425.6 bits, see alignment E=6.3e-132 PF02540: NAD_synthase" amino acids 2 to 68 (67 residues), 26.6 bits, see alignment E=6.3e-10 PF20259: tRNA_Me_trans_M" amino acids 202 to 269 (68 residues), 76.1 bits, see alignment E=2.6e-25 PF20258: tRNA_Me_trans_C" amino acids 279 to 353 (75 residues), 81.9 bits, see alignment E=6.8e-27

Best Hits

Swiss-Prot: 67% identical to MNMA_XANOP: tRNA-specific 2-thiouridylase MnmA (mnmA1) from Xanthomonas oryzae pv. oryzae (strain PXO99A)

KEGG orthology group: K00566, tRNA-specific 2-thiouridylase [EC: 2.8.1.-] (inferred from 66% identity to psu:Psesu_1532)

MetaCyc: 62% identical to tRNA-specific 2-thiouridylase (Escherichia coli K-12 substr. MG1655)
RXN0-2023 [EC: 2.8.1.13]

Predicted SEED Role

"tRNA-specific 2-thiouridylase MnmA"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.- or 2.8.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2A8E3 at UniProt or InterPro

Protein Sequence (376 amino acids)

>ABZR86_RS02185 tRNA 2-thiouridine(34) synthase MnmA (Dyella japonica UNC79MFTsu3.2)
MKVMLGISGGVDSSVAALLLQQAGHQVEGLFMQNWEEDERNGPCSADADRKDAVAVCGRL
GIPFHARNFAAEYWDGVFEHFLAEYRAGRTPNPDVLCNREIKFKTFLDEARALGAEKIAT
GHYARVDQRDGQYRLLRAVDASKDQTYFLHALGQRQLAATLFPVGEIEKSQVRRMALEAA
LPTHAKKDSTGICFIGERDFREFLSQYIPARPGEMRTPEGERIGEHQGVMYYTLGQRNGL
GIGGRQGASGEAWYVVGKDVHANVLYVAQGGENHWLHSHRLHAEAPTWVAGAAPAGEFRC
TAKTRYRQHDQACSVRVDADGVEVVFDEAQRAVTPGQSVVFYDGAACLGGAVIARTDAPY
GGWNAAPVPEESAQRV