Protein Info for ABZR86_RS02125 in Dyella japonica UNC79MFTsu3.2

Annotation: amidohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 PF00795: CN_hydrolase" amino acids 5 to 244 (240 residues), 114.2 bits, see alignment E=3.4e-37

Best Hits

Swiss-Prot: 49% identical to YAFV_ECOLI: Omega-amidase YafV (yafV) from Escherichia coli (strain K12)

KEGG orthology group: K08590, carbon-nitrogen hydrolase family protein (inferred from 63% identity to psu:Psesu_1275)

MetaCyc: 49% identical to 2-oxoglutaramate amidase (Escherichia coli K-12 substr. MG1655)
Omega-amidase. [EC: 3.5.1.111, 3.5.1.3]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.111 or 3.5.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2A6N0 at UniProt or InterPro

Protein Sequence (266 amino acids)

>ABZR86_RS02125 amidohydrolase (Dyella japonica UNC79MFTsu3.2)
MQALTVSLVQGATRWHDAPANRDYYGALVRGVAGKSDLIVLPETFLSGFSNDTRASAETM
DGEGVAWLRALAQEVGATLCGSLAIREGNTVYNRLLWVRPDGSFAQYDKRHLFRMAGEHT
RYGGGRERLVVELKGWRILPQVCYDLRFPVWLRNRRAEAAAGGMDYDLAVFVANWPAPRR
QPWRTLLRARAIENLSYVIGLNRVGVDGNDLPYAGDSAVLDAVGEPLIELGPQEQVATVT
LDPAPLLAHRERFPAWMDADEFSLQP