Protein Info for ABZR86_RS02125 in Dyella japonica UNC79MFTsu3.2

Annotation: amidohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00795: CN_hydrolase
  • amino acids 5 to 244 (240 residues), 114.2 bits, E=3.4e-37

Best Hits

Swiss-Prot: 49% identical to YAFV_ECOLI: Omega-amidase YafV (yafV) from Escherichia coli (strain K12)

KEGG orthology group: K08590, carbon-nitrogen hydrolase family protein (inferred from 63% identity to psu:Psesu_1275)

MetaCyc: 49% identical to 2-oxoglutaramate amidase (Escherichia coli K-12 substr. MG1655)
Omega-amidase. [EC: 3.5.1.111, 3.5.1.3]

Predicted SEED Role

No annotation

MetaCyc Pathways

• L-methionine salvage cycle III (11/11 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation I (7/7 steps found)
• L-methionine salvage cycle I (bacteria and plants) (10/12 steps found)
• L-methionine salvage cycle II (plants) (8/11 steps found)
• nicotine degradation I (pyridine pathway) (5/17 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Glutamate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.111 or 3.5.1.3

Sequence Analysis Tools

See A0A1I2A6N0 at UniProt or InterPro

Protein Sequence (266 amino acids)

>ABZR86_RS02125 amidohydrolase (Dyella japonica UNC79MFTsu3.2)
MQALTVSLVQGATRWHDAPANRDYYGALVRGVAGKSDLIVLPETFLSGFSNDTRASAETM
DGEGVAWLRALAQEVGATLCGSLAIREGNTVYNRLLWVRPDGSFAQYDKRHLFRMAGEHT
RYGGGRERLVVELKGWRILPQVCYDLRFPVWLRNRRAEAAAGGMDYDLAVFVANWPAPRR
QPWRTLLRARAIENLSYVIGLNRVGVDGNDLPYAGDSAVLDAVGEPLIELGPQEQVATVT
LDPAPLLAHRERFPAWMDADEFSLQP