Protein Info for ABZR86_RS01920 in Dyella japonica UNC79MFTsu3.2

Annotation: phosphoglucosamine mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02878: PGM_PMM_I
  • amino acids 4 to 137 (134 residues), 144.9 bits, E=2.6e-46
• TIGR01455: phosphoglucosamine mutase
  • amino acids 7 to 444 (438 residues), 601.7 bits, E=3.7e-185
• PF02879: PGM_PMM_II
  • amino acids 160 to 258 (99 residues), 64.5 bits, E=2.3e-21
• PF02880: PGM_PMM_III
  • amino acids 262 to 365 (104 residues), 104.7 bits, E=6.7e-34
• PF00408: PGM_PMM_IV
  • amino acids 375 to 444 (70 residues), 55.1 bits, E=1.3e-18

Best Hits

Swiss-Prot: 65% identical to GLMM_XYLFM: Phosphoglucosamine mutase (glmM) from Xylella fastidiosa (strain M12)

KEGG orthology group: K03431, phosphoglucosamine mutase [EC: 5.4.2.10] (inferred from 65% identity to xfm:Xfasm12_0810)

Predicted SEED Role

"Phosphoglucosamine mutase (EC 5.4.2.10)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 5.4.2.10)

MetaCyc Pathways

• superpathway of anaerobic sucrose degradation (17/19 steps found)
• O-antigen building blocks biosynthesis (E. coli) (10/11 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis I (5/5 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• peptidoglycan recycling I (11/14 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• glucose and glucose-1-phosphate degradation (4/5 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• sucrose degradation IV (sucrose phosphorylase) (3/4 steps found)
• colanic acid building blocks biosynthesis (8/11 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• chitin biosynthesis (6/9 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (3/5 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• glycogen degradation II (3/6 steps found)
• glucosylglycerol biosynthesis (2/5 steps found)
• sucrose biosynthesis II (4/8 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (1/4 steps found)
• starch degradation III (1/4 steps found)
• starch degradation V (1/4 steps found)
• glycogen degradation I (3/8 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (2/8 steps found)
• CMP-legionaminate biosynthesis I (2/10 steps found)
• starch biosynthesis (2/10 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (7/19 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (10/24 steps found)
• streptomycin biosynthesis (3/18 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.2.10

Sequence Analysis Tools

See A0A1I2ABI4 at UniProt or InterPro

Protein Sequence (450 amino acids)

>ABZR86_RS01920 phosphoglucosamine mutase (Dyella japonica UNC79MFTsu3.2)
MSERKYFGTDGIRGPVGQWPISADFMLRLGRAAGMALARDTREGRPKVLIGKDTRVSGYM
FEAALEAGLVAAGVDVGLLGPMPTPAVAFLTRSLRAQAGIVISASHNPHQDNGIKFFSAI
GEKLSDDVEAAIELGLDAEFTTEAPERLGKASRIDDAGGRYIEFCKRTLVDSEFTLRGLR
IVLDCANGATYQVAPKVFAELGAEVIAIGHKPDGFNINRGVGSTHPQTLQLAVLEHHADI
GIAFDGDGDRVQLVDREGVLADGDDMLFILARAWAAQGRLKGPVVGTLMSNYGLQQALAA
LDVDLIRANVGDRYVLQKLKEHGGQLGGETSGHILCLDRATTGDGIVSALAVLEALGGRD
LAEARQGLYKMPQIMINVRANGARESLHSDEVKQALAETEEALRGRGRVVLRASGTEPLV
RVTVEAADEAEVRRMAEQLAEVVKSAAERS