Protein Info for ABZR86_RS01890 in Dyella japonica UNC79MFTsu3.2

Annotation: aquaporin Z

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 37 to 56 (20 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details amino acids 206 to 225 (20 residues), see Phobius details PF00230: MIP" amino acids 5 to 224 (220 residues), 190.6 bits, see alignment E=1.7e-60 TIGR00861: MIP family channel proteins" amino acids 9 to 224 (216 residues), 215 bits, see alignment E=6e-68

Best Hits

Swiss-Prot: 80% identical to AQPZ_SHIFL: Aquaporin Z (aqpZ) from Shigella flexneri

KEGG orthology group: K06188, aquaporin Z (inferred from 88% identity to srs:SerAS12_0934)

MetaCyc: 80% identical to water channel AqpZ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-145

Predicted SEED Role

"Aquaporin Z"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2AF02 at UniProt or InterPro

Protein Sequence (232 amino acids)

>ABZR86_RS01890 aquaporin Z (Dyella japonica UNC79MFTsu3.2)
MSIGKRLTAEFFGTFWLVFGGCGSAVLAAAYPELGIGFAGVALAFGLTVVTMAYAVGHIS
GGHFNPAVTVGLCAGGRFPAKDVVPYIVAQVIGSIAAAAVLYVIASGKAGFDATAGFASN
GYGEHSPNGYSLHAAIVAELVLTAFFLLVIHGSTDKRAPAGFGPLAIGLALTLIHLISIP
VTNTSVNPARSTGVAIFQGTWALQQLWVFWLVPLIGGAVGGLIYRHLLESRD