Protein Info for ABZR86_RS01825 in Dyella japonica UNC79MFTsu3.2

Annotation: replication-associated recombination protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 PF05496: RuvB_N" amino acids 24 to 146 (123 residues), 49.5 bits, see alignment E=1.3e-16 PF00004: AAA" amino acids 57 to 165 (109 residues), 56.7 bits, see alignment E=1.1e-18 PF16193: AAA_assoc_2" amino acids 192 to 266 (75 residues), 80.4 bits, see alignment E=2.8e-26 PF12002: MgsA_C" amino acids 268 to 432 (165 residues), 211.6 bits, see alignment E=2e-66

Best Hits

Swiss-Prot: 54% identical to RARA_COXBU: Replication-associated recombination protein A (rarA) from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)

KEGG orthology group: K07478, putative ATPase (inferred from 77% identity to psu:Psesu_1544)

Predicted SEED Role

"FIG065221: Holliday junction DNA helicase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2AG16 at UniProt or InterPro

Protein Sequence (443 amino acids)

>ABZR86_RS01825 replication-associated recombination protein A (Dyella japonica UNC79MFTsu3.2)
MPSRGSSPDLFPESDELKPLAERMRPRSLDEIVGQQRVLAPGKALRRALEAGRVHSMVLW
GPPGCGKTTLALLVARYADADFRAISAVLSGLPEVRKALAEAEANFAQGRRTVLFVDEVH
RFNKAQQDAFLPHIERGVIIFVGATTENPSFELNSALLSRCRVHVLEAVSADDIVGALKR
ALEDAERGLGGQGLTVSDASLQLIARAADGDVRRALTLLEIAAELAEDGRIGEATLEQVL
ADRTRRFDKGGEQFYDQISALHKSVRSSDPDAALYWMCRMLDGGVDPLYLARRMTRMAVE
DVGLAEPRAWRMALDAWDTYERLGSPEGELGLAQLAIWLAMAPKSNAAYTAYNQARAVIR
ETGTLDVPMHLRNAPTRLLKGLGYGQGYQYDHDAEGGIALDQQCLPDALDGTVFYEPVER
GLELKLREKLLSLREARRQARGK