Protein Info for ABZR86_RS01810 in Dyella japonica UNC79MFTsu3.2

Annotation: DNA translocase FtsK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 776 transmembrane" amino acids 29 to 48 (20 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details amino acids 147 to 160 (14 residues), see Phobius details amino acids 168 to 190 (23 residues), see Phobius details PF13491: FtsK_4TM" amino acids 23 to 195 (173 residues), 143.1 bits, see alignment E=1.7e-45 PF17854: FtsK_alpha" amino acids 276 to 376 (101 residues), 100.7 bits, see alignment E=1.1e-32 PF01580: FtsK_SpoIIIE" amino acids 384 to 598 (215 residues), 260 bits, see alignment E=4.2e-81 PF01935: DUF87" amino acids 412 to 460 (49 residues), 24.7 bits, see alignment 6.1e-09 PF09397: FtsK_gamma" amino acids 712 to 771 (60 residues), 91.6 bits, see alignment 5.3e-30

Best Hits

Swiss-Prot: 73% identical to FTSK_XANCP: DNA translocase FtsK (ftsK) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K03466, DNA segregation ATPase FtsK/SpoIIIE, S-DNA-T family (inferred from 73% identity to psu:Psesu_1542)

Predicted SEED Role

"Cell division protein FtsK" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton or Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2AEC8 at UniProt or InterPro

Protein Sequence (776 amino acids)

>ABZR86_RS01810 DNA translocase FtsK (Dyella japonica UNC79MFTsu3.2)
MARSANVKKDKNKEPSGLSEELKRRLREAGALLLLPLALYLLVCLFSYNDQDPSWGHAST
VEHARNFGGAVGANIANLLRYIFGLVAYCFPLLLLGLGVQVLRHRGVRTVHPWEPSLRLI
GSVFFFITAPALLYLKFSDEPVLPQGVGGIIGMWVGRGLLQAFGGTGAPLLLLAIFLIAV
TLATGLSWFKLMDLTGQGMLKIAGWFGGKLKEAPEVLAARQARAEREVVKKVEAVKQAKR
EPVRIEAPPPPPPKSERARVETQIPLFTGASSAGELPPLSLLDEAPPQGPGYSEETLEVL
SRQVELKLKDFRIEAKVVGVYPGPVITRFELEPAAGVRGSQVSSLDKDIARGLSVVSVRV
VDVIPGKNVIGLEIPNAKKQVVYLSEILRSEKYDLTKSPLALALGKDIAGRPVVADLAKM
PHLLVAGTTGSGKSVAVNAMVLSLLYKASAKDVRMIMIDPKMLELSVYEGIPHLLAPVVT
DMKEAANALRWCVAEMERRYKLMAAVGVRNLAGFNKKVKDAENAGQPLLDPLFRPNPEMP
NLAAEPLEPLPYIVIIIDEFADMMMIVGKKVEELIARLAQKARAAGVHLVLATQRPSVDV
ITGLIKANIPTRIAFQVSSKIDSRTILDQSGAEALLGHGDMLHLPPGTATPERVHGAFVD
DHEVHNVVAWLKSQGSPQYIEGVLEEVQATSDGKFINDSGLPQEGEEGGDADAQLYDKAV
RIVTETRRASISGVQRHLRIGYNRAARLIEQMEQDGVVSAPQHNGNREVLAPPPPK