Protein Info for ABZR86_RS01790 in Dyella japonica UNC79MFTsu3.2

Annotation: leucyl/phenylalanyl-tRNA--protein transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 PF03588: Leu_Phe_trans" amino acids 37 to 206 (170 residues), 233.4 bits, see alignment E=5.6e-74 TIGR00667: leucyl/phenylalanyl-tRNA--protein transferase" amino acids 41 to 219 (179 residues), 203.1 bits, see alignment E=1.5e-64

Best Hits

Swiss-Prot: 58% identical to LFTR_XANAC: Leucyl/phenylalanyl-tRNA--protein transferase (aat) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K00684, leucyl/phenylalanyl-tRNA--protein transferase [EC: 2.3.2.6] (inferred from 58% identity to xac:XAC2003)

Predicted SEED Role

"Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6)" in subsystem Protein degradation (EC 2.3.2.6)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2ADZ3 at UniProt or InterPro

Protein Sequence (244 amino acids)

>ABZR86_RS01790 leucyl/phenylalanyl-tRNA--protein transferase (Dyella japonica UNC79MFTsu3.2)
MIRLPLLDAAHPEQFPDPGRAMADPNGLLAFGGDLTPRRLLAAYAGGIFPWYNEDEPILW
WSPDPRCVFHTDRLRANRSLRRQLAGRPWRITLDHAFRATVEACAAPRSGQLGTWIVPAM
AEAYIQLHEMGHAHSVEVWEGERLVGGIYGVTVGRLFCGESMFSRESGGSKLALLALGQL
LRRWDYPLIDAQVTNNHLLSLGAVEYPRDLFLKTVRQLVKLPGQPGSWKEFTPLVEQTMA
TLRR