Protein Info for ABZR86_RS01745 in Dyella japonica UNC79MFTsu3.2

Annotation: heavy metal-responsive transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 141 PF13411: MerR_1" amino acids 9 to 75 (67 residues), 75 bits, see alignment E=6.2e-25 PF00376: MerR" amino acids 9 to 46 (38 residues), 62.6 bits, see alignment E=3.5e-21 PF09278: MerR-DNA-bind" amino acids 51 to 115 (65 residues), 72.3 bits, see alignment E=6e-24

Best Hits

Swiss-Prot: 46% identical to HMMR_RHILV: HTH-type transcriptional regulator HmrR (hmrR) from Rhizobium leguminosarum bv. viciae

KEGG orthology group: K08365, MerR family transcriptional regulator, mercuric resistance operon regulatory protein (inferred from 55% identity to smt:Smal_2399)

Predicted SEED Role

"Transcriptional regulator, MerR family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2AF92 at UniProt or InterPro

Protein Sequence (141 amino acids)

>ABZR86_RS01745 heavy metal-responsive transcriptional regulator (Dyella japonica UNC79MFTsu3.2)
MDTHNPTLTIGAVAKRVGVNIDTIRFYEREGLLPEPVRRASGYRSYDEGAVRQLRFIRRA
KDLGFTLEEIRDLLALSADRQRGVKAVKKRAQERLAAIDARIAELTRVRDGLEELIDACP
GHGSPEQCPILRALSDAEDQA