Protein Info for ABZR86_RS01390 in Dyella japonica UNC79MFTsu3.2

Annotation: GH92 family glycosyl hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 811 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details TIGR01180: putative alpha-1,2-mannosidase" amino acids 35 to 792 (758 residues), 648.3 bits, see alignment E=7.2e-199 PF17678: Glyco_hydro_92N" amino acids 50 to 146 (97 residues), 122.3 bits, see alignment E=3.1e-39 amino acids 148 to 316 (169 residues), 135.2 bits, see alignment E=3.4e-43 PF07971: Glyco_hydro_92" amino acids 322 to 788 (467 residues), 575.4 bits, see alignment E=1.1e-176

Best Hits

KEGG orthology group: None (inferred from 61% identity to xfn:XfasM23_1932)

Predicted SEED Role

"Alpha-1,2-mannosidase" in subsystem Mannose Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2AMV1 at UniProt or InterPro

Protein Sequence (811 amino acids)

>ABZR86_RS01390 GH92 family glycosyl hydrolase (Dyella japonica UNC79MFTsu3.2)
MVTRRRFLQGAVAAALLGNRLDPFGSMAQAHAAGAKGGGAAEAATGVSRHVDVFIGTGGH
GHTYPGPSLPFGMVQLSPDTYDAQWDASSGYHQGDGSIMGFSHTHLSGTGAADMLDVLVM
PCTGPVRLQPGEREYRGTNYRSRYDGVPATNAPAPSNQGQPATRGYRSRYDAADEHARPG
YYQVRLKDYDVLAELTATLRAGLHRYTFHGKEEGHLLVDFAHGFHDDPATPTKVTDASLR
LVGKDTLVGSRRVHQWANNRYIHFAMKVSRPFDRAVLYSGDAPLAGAREAAGTNLKATLH
YTHPDKAPLLVKVGISGVDIDGALRNLDAEVPGWDFDGARDAAAAAWEKELGRIRVDAAT
EDTKKVFYSALYHTMLAPTLFSDVDGRYRGMDLQVHQLPEGSHNYSTYSLWDTYRAAHPL
YTLFQAERVPDLVNGLLRMAAESPDGPPVWPLQGVETGCMIGYHSAVVVSEAVAKGFAGV
DPKQAWPLFRKRAMEDDYRGLAYYRKLGYIPADKEWEAVSKTLEYAYDDWALSHLADAAG
AKDDAEALRRRSRNYRNVFDKSVAFMRPRGEHGQWLEPFDPRSIGHSKQWRDFTESNAWQ
ATFLNQHDLYGYMELFGGQPAFERKLDELFTTSSELPADAPPDIAGLVGQYAHGNEPGHH
MPYLYAYTGAHYKTQSRVRMLLTDMYRADPDGLAGNEDCGQMSAWYVLGAMGLYPVDPVS
THYVFGSPVLDRAEVDIAGKRLVVEAKDNAADSPYIQSVTWNGQPWSKSWIAHADLAAGG
TLVFQMGKAPNKQFGAAPADRPPSFGAAMKA