Protein Info for ABZR86_RS01330 in Dyella japonica UNC79MFTsu3.2

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF00106: adh_short" amino acids 8 to 188 (181 residues), 166.6 bits, see alignment E=9.8e-53 PF08659: KR" amino acids 11 to 156 (146 residues), 31.6 bits, see alignment E=3e-11 PF01370: Epimerase" amino acids 15 to 167 (153 residues), 27.1 bits, see alignment E=5.4e-10 PF13561: adh_short_C2" amino acids 16 to 247 (232 residues), 209.7 bits, see alignment E=9.7e-66

Best Hits

Swiss-Prot: 71% identical to FUCDH_XANCP: 2-keto-3-deoxy-L-fuconate dehydrogenase (XCC4067) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: None (inferred from 72% identity to xal:XALc_0446)

MetaCyc: 71% identical to 2-dehydro-3-deoxy-L-fuconate 4-dehydrogenase (Xanthomonas campestris pv. campestris)
RXN-22641 [EC: 1.1.1.434]

Predicted SEED Role

"2-keto-3-deoxy-L-fuconate dehydrogenase" in subsystem L-fucose utilization temp

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.434

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2APH9 at UniProt or InterPro

Protein Sequence (248 amino acids)

>ABZR86_RS01330 SDR family oxidoreductase (Dyella japonica UNC79MFTsu3.2)
MSGRLAGKHALVTAAGAGIGRATALAFAREGARVLATDIDEQALAALSAEAPELRTERLD
VTDPVQIDRLVASHPPFDVLFNCAGYVHAGTILDTDDAAWKRSFAINVDSMFHLCQRVLP
AMLERGGGSIVNMSSVASSIKGVPNRFAYSTTKAAVIGLTKSVAADFVGRGIRCNAICPG
TVKTPSLGDRVRALGGDEDAVWRGFVERQPMGRLGNPEEIAMLALYLASDEAAFTTGTVH
IVDGGWSN