Protein Info for ABZR86_RS01325 in Dyella japonica UNC79MFTsu3.2

Annotation: fumarylacetoacetate hydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01557: FAA_hydrolase
  • amino acids 72 to 278 (207 residues), 254.3 bits, E=4.9e-80

Best Hits

Swiss-Prot: 62% identical to UGL_BURL3: Ureidoglycolate lyase (Bcep18194_B0137) from Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)

KEGG orthology group: None (inferred from 71% identity to xcb:XC_4158)

MetaCyc: 64% identical to 2,4-didehydro-3-deoxy-L-fuconate hydrolase (Burkholderia multivorans)
RXN-12096 [EC: 3.7.1.26]

Predicted SEED Role

"Fumarylacetoacetate hydrolase family protein" in subsystem Gentisare degradation or Salicylate and gentisate catabolism

MetaCyc Pathways

• L-fucose degradation III (5/8 steps found)
• L-arabinose degradation V (3/6 steps found)
• L-rhamnose degradation III (2/7 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.26

Sequence Analysis Tools

See A0A1I2AQE8 at UniProt or InterPro

Protein Sequence (288 amino acids)

>ABZR86_RS01325 fumarylacetoacetate hydrolase family protein (Dyella japonica UNC79MFTsu3.2)
MKLVRYGAHGNEKPGLIDKDGALRDLSEHVADIDPYVLGREGRARLAAIDPASLPEVEGT
PRFGAPVAPVSKIICVGMNYARHAAETGQPVPAQPVLFMKATTAIMGPNDDVVIPRGSTC
TDWEVELGVVIGETARDVSVDEALAHVAGFIVINDLSEREFQLEHGGQWVKGKSCDSFGP
LGPWLVTIDEVPDPQNLHLWLEVNGHRYQDSNTSDMVFGVAKLVSYISRYMTLLPGDVIS
TGTPAGVGLGLKPPTYLRPGDVIELGIDGLGRQRQQVRAHPADASAAR