Protein Info for ABZR86_RS01320 in Dyella japonica UNC79MFTsu3.2

Annotation: enolase C-terminal domain-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 PF02746: MR_MLE_N" amino acids 39 to 138 (100 residues), 23.2 bits, see alignment E=7e-09 PF13378: MR_MLE_C" amino acids 206 to 419 (214 residues), 222.7 bits, see alignment E=4.9e-70

Best Hits

Swiss-Prot: 76% identical to FUCD_XANCP: L-fuconate dehydratase (XCC4069) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: None (inferred from 78% identity to xal:XALc_0448)

MetaCyc: 76% identical to L-fuconate dehydratase monomer (Xanthomonas campestris pv. campestris)
L-fuconate dehydratase. [EC: 4.2.1.68]

Predicted SEED Role

"L-fuconate dehydratase (EC 4.2.1.68)" in subsystem L-fucose utilization temp (EC 4.2.1.68)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.68

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2AP59 at UniProt or InterPro

Protein Sequence (442 amino acids)

>ABZR86_RS01320 enolase C-terminal domain-like protein (Dyella japonica UNC79MFTsu3.2)
MAKHAPVKITALDTYDIRFPTSRQLDGSDAMNPDPDYSAAYAVLRTDDPALAGYGLAFTI
GRGNDVQKAALDALRPYVVGLTLDEVTNDLGGFAARMVGDSQLRWLGPEKGVMHMAIGAV
INAGWDLAARRAGKPLWRYIAELTPEQLVATIDFRYLSDAITPDEALQMLRAAEPAKSAR
IEQLLAEGYPAYTTSPGWLGYTDEKMLRLAREAVADGFRTIKLKVGLSVEDDVRRCSLVR
QTVGPDVAIAVDANQRWDVHAAIDWLRRLEGFDLAWIEEPTSPDDVLGHAAIRRAVSVPV
STGEHTQNRVIFKQLFQAGAVDLVQIDAARVGGVNENLAILLMAAKFGVRVFPHAGGVGL
CELVQHLAMADFVAITGRKDDRAIEFVDHLHEHFDDPVTIRDGHYLAPTAPGFSARMHES
TLVEYRFPDGPVWSEQTVAALH