Protein Info for ABZR86_RS01270 in Dyella japonica UNC79MFTsu3.2

Annotation: response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 PF00072: Response_reg" amino acids 3 to 113 (111 residues), 97.4 bits, see alignment E=5.9e-32 PF00486: Trans_reg_C" amino acids 145 to 215 (71 residues), 74 bits, see alignment E=8.4e-25

Best Hits

Swiss-Prot: 43% identical to QSEB_SALTI: Transcriptional regulatory protein QseB (qseB) from Salmonella typhi

KEGG orthology group: K02483, two-component system, OmpR family, response regulator (inferred from 51% identity to app:CAP2UW1_1183)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2AQZ2 at UniProt or InterPro

Protein Sequence (221 amino acids)

>ABZR86_RS01270 response regulator (Dyella japonica UNC79MFTsu3.2)
MHILLIEDDPLLGKAIQRALEQLAYTLTWVRDGREAMAAVNDPSVDLILLDLGLPNRDGF
EILTEARGRRLRTPIIVMTARDDLESRIRGLDAGADDYMVKPFHLDELAARIRSTARRAN
GMADNRIEVGPLVLNSAAVEVSYQGRKVELSRREFALLQYLMERAGRVVRREQLESSLYG
WDNDVGSGALDVLVHGLRRKLSFDAIKTVRGFGYTIPLDHS