Protein Info for ABZR86_RS01175 in Dyella japonica UNC79MFTsu3.2

Annotation: L-rhamnose mutarotase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 115 PF05336: rhaM" amino acids 3 to 111 (109 residues), 100.3 bits, see alignment E=3.5e-33

Best Hits

Swiss-Prot: 58% identical to FUCM_XANCP: L-fucose mutarotase (XCC4070) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K03534, L-rhamnose mutarotase [EC: 5.1.3.-] (inferred from 59% identity to xcv:XCV4288)

Predicted SEED Role

"L-fucose mutarotase, type 2"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.-

Use Curated BLAST to search for 5.1.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2AT11 at UniProt or InterPro

Protein Sequence (115 amino acids)

>ABZR86_RS01175 L-rhamnose mutarotase (Dyella japonica UNC79MFTsu3.2)
MPRMYFALDLHDDPQSIAEYERWHRPGQIWPEIVASIREAGVLDLEIFRTRNRLVLAMDV
TDDFDGAAKAAADAANPRVQAWESLMDTFQQRLPWAKPGQKWVPMERIFSLRECP