Protein Info for ABZR86_RS01170 in Dyella japonica UNC79MFTsu3.2

Annotation: L-fucose:H+ symporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 49 to 71 (23 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 105 to 123 (19 residues), see Phobius details amino acids 143 to 166 (24 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details amino acids 245 to 267 (23 residues), see Phobius details amino acids 282 to 300 (19 residues), see Phobius details amino acids 312 to 332 (21 residues), see Phobius details amino acids 338 to 358 (21 residues), see Phobius details amino acids 370 to 390 (21 residues), see Phobius details amino acids 396 to 415 (20 residues), see Phobius details TIGR00885: L-fucose:H+ symporter permease" amino acids 14 to 414 (401 residues), 433.8 bits, see alignment E=3.9e-134 PF07690: MFS_1" amino acids 22 to 377 (356 residues), 82.2 bits, see alignment E=3.5e-27

Best Hits

KEGG orthology group: K02429, MFS transporter, FHS family, L-fucose permease (inferred from 65% identity to xac:XAC4190)

Predicted SEED Role

"Fucose permease" in subsystem L-fucose utilization or L-fucose utilization temp

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2AVK4 at UniProt or InterPro

Protein Sequence (422 amino acids)

>ABZR86_RS01170 L-fucose:H+ symporter permease (Dyella japonica UNC79MFTsu3.2)
MAASSSRAAGRSPLPLALIVSLFFLWGVANNLNDVLIPQFKKAFVLNDFQAGLVQSAFYL
GYFLVAMPAGIYMRRFGYKSAVVFGLALYGLGALLFWPAAQQGTYGFFLFALFVIASGLA
FLETSANPFVTLLGPRESAARRLNLAQAFNPLGSITGILIGQHFIFSGVEHTPEQLAALS
AAERAAFVAHETAAVQLPYLAIGLVVLAWGLLILLTRFPAVHAVEEGAVPRDHGALARLL
GDRRFLATLAAQFFYVGAQVGVWSYLIRYVQATMPGTPAKLAANYMLVSLACFMAGRFAG
SALMRYVAPRRLLALFAAVNVALTVFAVAVPGVAGACALVACSFFMSVMYPTIFALGVEG
RGDDERKLGSALLVMTIIGGAVLTAAMGAVSDAAGISRAMLVPAASFVVILLFARLRGAV
ER