Protein Info for ABZR86_RS01095 in Dyella japonica UNC79MFTsu3.2

Annotation: elongation factor G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 721 TIGR00484: translation elongation factor G" amino acids 1 to 718 (718 residues), 867.4 bits, see alignment E=6.8e-265 PF00009: GTP_EFTU" amino acids 10 to 309 (300 residues), 213.2 bits, see alignment E=6.3e-67 TIGR00231: small GTP-binding protein domain" amino acids 11 to 183 (173 residues), 93.2 bits, see alignment E=1.5e-30 PF03144: GTP_EFTU_D2" amino acids 351 to 418 (68 residues), 54.7 bits, see alignment E=2.8e-18 PF14492: EFG_III" amino acids 431 to 505 (75 residues), 104.1 bits, see alignment E=8.4e-34 PF03764: EFG_IV" amino acids 506 to 622 (117 residues), 124.2 bits, see alignment E=6.6e-40 PF00679: EFG_C" amino acids 627 to 712 (86 residues), 95.1 bits, see alignment E=5.4e-31

Best Hits

KEGG orthology group: K02355, elongation factor G (inferred from 63% identity to rce:RC1_3537)

Predicted SEED Role

"Translation elongation factor G" in subsystem Translation elongation factor G family or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2CQZ6 at UniProt or InterPro

Protein Sequence (721 amino acids)

>ABZR86_RS01095 elongation factor G (Dyella japonica UNC79MFTsu3.2)
MPRQKPLSLYRNIGIIAHIDAGKTTTTERVLYYTGKKHQIVDVHDTKDGKGSTTTDYLEQ
ERKRGITIQSAAVSTEWKGHQINVIDTPGHVDFTIEVNRSLRVLDGAVVVFDGVAGVEPQ
TETNWRLADQYNVPRMCYINKMDRIGANFKHAVEGIKNRLGANALLCQVPLGSHDEFIGM
ADLVAGVAYVWQGDDKDSTWESIPLDQVASHPKCQFTAAGDREWVANLVKLHEETIERAL
EMDDEAFDKLLHAGDVETFVKSSDFSMDLLKKAIRKGCVSGKLVPVFCGSSYRNKGVQQL
LDAVVDYMPYPGENGGIALVDEDGHVVGEQGVVDEAPARLLAFKVINDQFGSLTFCRIYS
GVIKKGDTLQNVTRGKKERIGRIVEVQANATKDIEEVRAGDICAFVSLKETETGDSLTDP
AHPVLLERMRFPDPVISVAVEPKNRNDIDKLSTALYKMVKADPSLKLEVDKETGETVLKG
MGELHLEITIDRMRTELGVDASMGKPRVSFREAFGKTVEHTYTHKKQSGGSGQFAEVKVI
FERGEPGSGVVFSDEIVGGRVPREYIPAVEHAITVESREGQVAGYEVLDFKARLVDGKYH
DVDSSALAFEIAGKACFREAHKLSNPKLLEPVMKLEVVTEADYLGDVIGDINRRRGSVSD
QGQRGTNAFVQGFVPLAEMFGYINFLRSATSGRGTFTMEFDHYEEVPASMVAKLMEKEGA
K