Protein Info for ABZR86_RS01040 in Dyella japonica UNC79MFTsu3.2

Annotation: histidine kinase dimerization/phospho-acceptor domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 609 transmembrane" amino acids 29 to 49 (21 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 203 to 223 (21 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 113 to 169 (57 residues), 25.6 bits, see alignment 5.8e-10 PF00989: PAS" amino acids 114 to 190 (77 residues), 32.7 bits, see alignment E=1.7e-11 PF08448: PAS_4" amino acids 119 to 215 (97 residues), 31.9 bits, see alignment E=3.4e-11 PF00512: HisKA" amino acids 246 to 306 (61 residues), 53.8 bits, see alignment 4.2e-18 PF01627: Hpt" amino acids 499 to 568 (70 residues), 32.6 bits, see alignment E=2e-11

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2CQ33 at UniProt or InterPro

Protein Sequence (609 amino acids)

>ABZR86_RS01040 histidine kinase dimerization/phospho-acceptor domain-containing protein (Dyella japonica UNC79MFTsu3.2)
MTEEHRGAATAVIQAAAGQERSGGGRGILAMRLMAIEMCMGRPGVMAWIGARPRSANELS
ALAFASAVEAPEGWFVHAALGMVLLGVGAMAWSLRRHAREQASARRRREAGSDRYEAIFH
AMPFPAFCKDASGGYLAVNRAYEDAFGIEAQRLIGRDLAQTRHLDLDCERMHAAHLQVIR
SATSASDDLILSDARHGARAFRLWLIAMGPRLDGVALLGIVVAADRPPRPAETACVPSRT
VLDHALLSAVSHDVRTPLTGIMGALELLGYAELTTRQRALVSGAENASRALQDILDDLLA
LARLETEGTVRPDQPIDLRGLLAGLLAKHGTGGGVLDLDERLAPRLMGDGHALRRALGKL
LVHYFSLGLGRAPRWDVRVLAQGAQWQSIELVLAPLPATAAQAEASAPASHGNQLAWIAA
CKLCESMGFSLREQGSGGTGPRFVMHGSLPLAADETRHETGGGAQSLEVAELARLAQEDA
GHVARRLADVFGDDAGAIADYLHLVRNEEQRLQANLDAGDTSRLREAAHYLSGMGSFFGA
QRLASMATALELGRGRDEVIERAEALRTYLTCFIESLHGNTCEATAITNNTMVISDVSHG
KVSSAALEL