Protein Info for ABZR86_RS01000 in Dyella japonica UNC79MFTsu3.2

Annotation: cytochrome P450

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 transmembrane" amino acids 135 to 148 (14 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details PF00067: p450" amino acids 214 to 309 (96 residues), 42.9 bits, see alignment E=1.5e-15

Best Hits

KEGG orthology group: None (inferred from 69% identity to xal:XALc_2283)

Predicted SEED Role

"FIG01125958: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2CPK4 at UniProt or InterPro

Protein Sequence (344 amino acids)

>ABZR86_RS01000 cytochrome P450 (Dyella japonica UNC79MFTsu3.2)
MPPIARHVRSTVFASRLQALLREHAGDDLFRLDANTVGVAGPDLIDRVLKARPATEFERP
TFKPLHGRSIPRPDALKSMQAIARDVRAALKKPVPDDVDLSGPWPHVGHVYLRDLILGED
PRRLRFLMDRILELTPKLTWAVVATGALFPLRPRPQASALAVATAAATSYHDRRYAMGMY
RRTAAPVCFTISTLVANAIWLGAPFGDGLSNRHILYETLRLLPPSWNILRNASPEYTAID
ARIGPADDVLILPLVSHRAPALWDDPDEFLPERWKHLSADDLPGYLPFGHKSERCWGQHM
VLPLAEMFLDLLRRQRLTVSPRQTVAHVPLAGLLGVAEVQVAPL