Protein Info for ABZR86_RS00920 in Dyella japonica UNC79MFTsu3.2
Annotation: 50S ribosomal protein L21
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 72% identical to RL21_THISH: 50S ribosomal protein L21 (rplU) from Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
KEGG orthology group: K02888, large subunit ribosomal protein L21 (inferred from 72% identity to tgr:Tgr7_3206)MetaCyc: 53% identical to 50S ribosomal subunit protein L21 (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"LSU ribosomal protein L21p" in subsystem Ribosome LSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1I2CMZ6 at UniProt or InterPro
Protein Sequence (104 amino acids)
>ABZR86_RS00920 50S ribosomal protein L21 (Dyella japonica UNC79MFTsu3.2) MSYAVIKTGGKQYRVQQGDVLRVELLNADEGASVKFDQVLLVGSGETITVGAPTVAGATV SATVRKHGRADKVRIIKFRRRKHHKKQQGHRQHFTEVEITGINA