Protein Info for ABZR86_RS00870 in Dyella japonica UNC79MFTsu3.2
Annotation: enoyl-CoA hydratase-related protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 46% identical to CRT_CLOAB: Short-chain-enoyl-CoA hydratase (crt) from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)
KEGG orthology group: None (inferred from 67% identity to xal:XALc_1985)MetaCyc: 46% identical to 3-hydroxypropionyl-CoA dehydratase (Metallosphaera sedula)
RXN-6383 [EC: 4.2.1.116]
Predicted SEED Role
"Enoyl-CoA hydratase (EC 4.2.1.17)" in subsystem Acetyl-CoA fermentation to Butyrate or Butanol Biosynthesis or Isoleucine degradation or Polyhydroxybutyrate metabolism or Valine degradation or n-Phenylalkanoic acid degradation (EC 4.2.1.17)
MetaCyc Pathways
- oleate β-oxidation (32/35 steps found)
- fatty acid β-oxidation I (generic) (6/7 steps found)
- superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
- acrylate degradation II (3/3 steps found)
- benzoyl-CoA biosynthesis (3/3 steps found)
- fatty acid salvage (5/6 steps found)
- adipate degradation (4/5 steps found)
- L-isoleucine degradation I (4/6 steps found)
- pyruvate fermentation to butanol II (engineered) (4/6 steps found)
- adipate biosynthesis (3/5 steps found)
- fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
- fatty acid β-oxidation IV (unsaturated, even number) (3/5 steps found)
- glutaryl-CoA degradation (3/5 steps found)
- L-tryptophan degradation III (eukaryotic) (10/15 steps found)
- pyruvate fermentation to hexanol (engineered) (7/11 steps found)
- 2-methyl-branched fatty acid β-oxidation (9/14 steps found)
- superpathway of coenzyme A biosynthesis II (plants) (6/10 steps found)
- methyl ketone biosynthesis (engineered) (3/6 steps found)
- propanoate fermentation to 2-methylbutanoate (3/6 steps found)
- 3-hydroxypropanoate cycle (8/13 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
- valproate β-oxidation (5/9 steps found)
- 3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
- fatty acid β-oxidation VI (mammalian peroxisome) (3/7 steps found)
- pyruvate fermentation to butanoate (3/7 steps found)
- L-glutamate degradation V (via hydroxyglutarate) (5/10 steps found)
- β-alanine biosynthesis II (2/6 steps found)
- superpathway of Clostridium acetobutylicum acidogenic fermentation (4/9 steps found)
- glycerol degradation to butanol (9/16 steps found)
- acrylate degradation I (1/5 steps found)
- benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (1/5 steps found)
- propanoyl-CoA degradation II (1/5 steps found)
- L-valine degradation I (3/8 steps found)
- pyruvate fermentation to butanol I (3/8 steps found)
- (8E,10E)-dodeca-8,10-dienol biosynthesis (5/11 steps found)
- benzoyl-CoA degradation I (aerobic) (2/7 steps found)
- 3-phenylpropanoate degradation (4/10 steps found)
- glyoxylate assimilation (6/13 steps found)
- benzoate biosynthesis I (CoA-dependent, β-oxidative) (3/9 steps found)
- superpathway of Clostridium acetobutylicum solventogenic fermentation (5/13 steps found)
- phenylacetate degradation I (aerobic) (2/9 steps found)
- L-glutamate degradation VII (to butanoate) (4/12 steps found)
- superpathway of phenylethylamine degradation (3/11 steps found)
- superpathway of the 3-hydroxypropanoate cycle (8/18 steps found)
- gallate degradation III (anaerobic) (2/11 steps found)
- superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (6/17 steps found)
- (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (2/13 steps found)
- docosahexaenoate biosynthesis III (6-desaturase, mammals) (2/14 steps found)
- crotonate fermentation (to acetate and cyclohexane carboxylate) (3/16 steps found)
- benzoate fermentation (to acetate and cyclohexane carboxylate) (3/17 steps found)
- toluene degradation VI (anaerobic) (3/18 steps found)
- platensimycin biosynthesis (6/26 steps found)
- Spodoptera littoralis pheromone biosynthesis (3/22 steps found)
KEGG Metabolic Maps
- Benzoate degradation via CoA ligation
- Biosynthesis of plant hormones
- Biosynthesis of unsaturated fatty acids
- Butanoate metabolism
- Caprolactam degradation
- Fatty acid elongation in mitochondria
- Fatty acid metabolism
- Geraniol degradation
- Limonene and pinene degradation
- Lysine degradation
- Propanoate metabolism
- Tryptophan metabolism
- Valine, leucine and isoleucine degradation
- alpha-Linolenic acid metabolism
- beta-Alanine metabolism
Isozymes
Compare fitness of predicted isozymes for: 4.2.1.17
Use Curated BLAST to search for 4.2.1.116 or 4.2.1.17
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1I2CMK0 at UniProt or InterPro
Protein Sequence (260 amino acids)
>ABZR86_RS00870 enoyl-CoA hydratase-related protein (Dyella japonica UNC79MFTsu3.2) MAYRNLDIGNRGAVRIITVNRPDKLNALNRDTLNELTLAFAQAAQDDAVRTVVLAGAGDK AFVAGADIAEMNGYTPVQAQGFSRAGQRLMSSIERLGKPVVARIQGFALGGGMELAMACH LRVASEKARFGQPEINLGLIPGFGGTQRLLRLAGRGAALELCLTGAMVGAQRAYELGVVN RVVAPEALDETVDALADQLAASAPLAAAGILDAILQGGEMALDQGLEFETQAFALAFSTE DMREGTTAFLEKRKAEFKGR