Protein Info for ABZR86_RS00805 in Dyella japonica UNC79MFTsu3.2

Annotation: polynucleotide adenylyltransferase PcnB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 TIGR01942: poly(A) polymerase" amino acids 15 to 448 (434 residues), 492.7 bits, see alignment E=4.2e-152 PF01743: PolyA_pol" amino acids 46 to 176 (131 residues), 120.2 bits, see alignment E=1.1e-38 PF12627: PolyA_pol_RNAbd" amino acids 204 to 265 (62 residues), 58.7 bits, see alignment E=6.1e-20 PF12626: PolyA_pol_arg_C" amino acids 320 to 445 (126 residues), 125.2 bits, see alignment E=2.2e-40

Best Hits

KEGG orthology group: K00970, poly(A) polymerase [EC: 2.7.7.19] (inferred from 63% identity to xcv:XCV1814)

Predicted SEED Role

"Poly(A) polymerase (EC 2.7.7.19)" in subsystem Polyadenylation bacterial (EC 2.7.7.19)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2CL87 at UniProt or InterPro

Protein Sequence (458 amino acids)

>ABZR86_RS00805 polynucleotide adenylyltransferase PcnB (Dyella japonica UNC79MFTsu3.2)
MNLKARNEATPSLRIIPREQHVISRKNISKAALRVLYRLHEAGYDAFLVGGAVRDLLLGG
HPKDFDVATNATPEDVKKLFRNCRLIGRRFRLAHVVYGPEIIEVATFRGTGEDDGSEGGG
DRHIVDGRIVRDNVWGSIEEDALRRDFRVNALYYDISDFSVRDYVGGMQDVENRVLHLIG
DPVTRYREDPVRMLRAVRLAAKLNFRIDGAAFAPFEELGPLLLDASPARLFDESLKLFLS
GHGLKSFRMLEQSGLLKFMFPATARSLKRGDEALRQLIEEGLGSTDARVAEGKSVTPAFL
FAVLLWGEVRDLAHAWIVKGVESGQAWGRAVAHVVSEQCQRVAIPRRFTITMEEIWALQP
RFEQVQRKRVFRLMAHPRFRAAFDFLLLRATESPAVRELGQWWLHAQQLPHETLAAALSG
SGGDIPSAGGPDPAPASKPRKRRRRKPGGKSGGKSGAA