Protein Info for ABZR86_RS00640 in Dyella japonica UNC79MFTsu3.2

Annotation: sigma-70 family RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 22 to 175 (154 residues), 72.4 bits, see alignment E=1.7e-24 PF04542: Sigma70_r2" amino acids 26 to 89 (64 residues), 43.1 bits, see alignment E=4.6e-15 PF08281: Sigma70_r4_2" amino acids 123 to 173 (51 residues), 48.8 bits, see alignment E=6.4e-17 PF04545: Sigma70_r4" amino acids 126 to 175 (50 residues), 24.9 bits, see alignment E=1.8e-09

Best Hits

Swiss-Prot: 31% identical to FECI_ECOLI: Probable RNA polymerase sigma factor FecI (fecI) from Escherichia coli (strain K12)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 36% identity to pmk:MDS_2734)

MetaCyc: 31% identical to RNA polymerase sigma factor FecI (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2CHI7 at UniProt or InterPro

Protein Sequence (183 amino acids)

>ABZR86_RS00640 sigma-70 family RNA polymerase sigma factor (Dyella japonica UNC79MFTsu3.2)
MDTVSPHPDDPATRTATHVARLEALCRTHHRALLAFLQCRLQSPSDAQEVAQEAYVRMLT
LARPDSVDDLRAYLFRTASNLAMDRLRQRGIHARAVDEVAIREAQTAPAPERRAMAVERL
HGLKQALGELPPKTREAFMAHMVEGLDFGAVARAMKLSERMVRYHVTRALAHCRARVDQM
EEC