Protein Info for ABZR86_RS00600 in Dyella japonica UNC79MFTsu3.2

Annotation: AEC family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 31 to 47 (17 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 120 to 146 (27 residues), see Phobius details amino acids 158 to 180 (23 residues), see Phobius details amino acids 186 to 206 (21 residues), see Phobius details amino acids 218 to 240 (23 residues), see Phobius details amino acids 244 to 266 (23 residues), see Phobius details amino acids 276 to 298 (23 residues), see Phobius details PF03547: Mem_trans" amino acids 1 to 132 (132 residues), 47.6 bits, see alignment E=4.9e-17 amino acids 155 to 293 (139 residues), 42.3 bits, see alignment E=2e-15

Best Hits

Predicted SEED Role

"Malate permease" in subsystem Pyruvate metabolism I: anaplerotic reactions, PEP

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2CF91 at UniProt or InterPro

Protein Sequence (300 amino acids)

>ABZR86_RS00600 AEC family transporter (Dyella japonica UNC79MFTsu3.2)
MTALILLFACLLLGLLVRRYARPPAGTVQGINWWVINIALPALVLQLVPKVQVDAQLWFP
VATMWITFFGAWGLFALLGRWLGWSRGRIGALTLVCGLGNTSFMGYPMMQALHGSEGLTL
AVVADQLGCFPLLASAGVVVANLYAGGSTDAAAIVRRILTFPAFLALVLGGIAGALGGWP
TIVDGVLGQVGATLTPLALFSVGLQFQFKLGERQAGPLALGLAWKLALAPLLSLAVGVAA
GVGGLVLTIGVLQAAMAPMISAAILADEHGLEPSLANTVLGAGIVLSLATVPLANLLLGG