Protein Info for ABZR86_RS00575 in Dyella japonica UNC79MFTsu3.2

Annotation: tRNA glutamyl-Q(34) synthetase GluQRS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details TIGR03838: glutamyl-queuosine tRNA(Asp) synthetase" amino acids 3 to 260 (258 residues), 347.7 bits, see alignment E=2.3e-108 PF00749: tRNA-synt_1c" amino acids 4 to 234 (231 residues), 116.6 bits, see alignment E=5.5e-38

Best Hits

Swiss-Prot: 55% identical to GLUQ_XANAC: Glutamyl-Q tRNA(Asp) synthetase (gluQ) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K01894, glutamyl-Q tRNA(Asp) synthetase [EC: 6.1.1.-] (inferred from 56% identity to tgr:Tgr7_1031)

MetaCyc: 48% identical to glutamyl-Q tRNAAsp synthetase (Escherichia coli K-12 substr. MG1655)
2.4.1.M62 [EC: 2.4.1.M62]

Predicted SEED Role

"glutamyl-Q-tRNA synthetase" in subsystem Queuosine-Archaeosine Biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.-

Use Curated BLAST to search for 2.4.1.M62 or 6.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2CEL9 at UniProt or InterPro

Protein Sequence (288 amino acids)

>ABZR86_RS00575 tRNA glutamyl-Q(34) synthetase GluQRS (Dyella japonica UNC79MFTsu3.2)
MTYRGRFAPSPTGRLHFGSLVAAVASWLCARHAGGRWLLRMEDIDPPREVPGSARDILDA
LPAFGLAADEPVLFQSHRLDAYEAAFQRLRDHDQVFPCWCSRADLAAAGGMHRDGHCVAS
PDPSRAPAWRLRAPDLEIAFVDRLQGPQRQNLRQAAGDFVIKRVEGFYAYQLACAVDDAW
QGVTEVVRGNDLLDSTARQLWLQRCLGLPTPAYLHLPLAVDADGRKLSKSENAHPVDPRD
PLPALQRALHFLDLPVDASANHPDALLSQALAHFDPARLPHCSERPAS