Protein Info for ABZR86_RS00545 in Dyella japonica UNC79MFTsu3.2

Annotation: NADH:flavin oxidoreductase/NADH oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 PF00724: Oxidored_FMN" amino acids 2 to 336 (335 residues), 243.2 bits, see alignment E=2.5e-76

Best Hits

Swiss-Prot: 50% identical to NAMA_GEOTN: NADPH dehydrogenase (namA) from Geobacillus thermodenitrificans (strain NG80-2)

KEGG orthology group: None (inferred from 65% identity to ade:Adeh_3719)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2CEM7 at UniProt or InterPro

Protein Sequence (350 amino acids)

>ABZR86_RS00545 NADH:flavin oxidoreductase/NADH oxidase (Dyella japonica UNC79MFTsu3.2)
MQLFTPFTQRGLTLRNRIAVAPMCQYSAVDGVPDHWHLVHLGSRAVGGAAVVIAEATAVT
AQGRISPQDVGLWNDAQREAWRPITRFIDTQGAIAGVQLAHAGRKASSQRPWEGGGALRE
GAWDTVAPSAIAFDEGWHTPQALDAAGLRQLVEDFRRAAERALAAGFRLVELHAAHGYLL
HQFLSPLSNHREDAYGGSFENRTRLLREIIAAVREVWPAELPLWVRISATDWHEGGWDIE
QSVRLARELPALGVDLVDVSSGGLVPHVKIPLGPGYQVPFAARIRREAGIATGAVGLITE
SDQAARIVAQDEADIVLIARESLRDPYFPRRAAQELGASLEAPVQYRRAW