Protein Info for ABZR86_RS00370 in Dyella japonica UNC79MFTsu3.2

Annotation: aromatic ring-hydroxylating dioxygenase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00355: Rieske
  • amino acids 43 to 131 (89 residues), 61.9 bits, E=4.5e-21
• PF00848: Ring_hydroxyl_A
  • amino acids 179 to 356 (178 residues), 127.7 bits, E=5.8e-41

Predicted SEED Role

"Benzoate 1,2-dioxygenase (EC 1.14.12.10)" (EC 1.14.12.10)

MetaCyc Pathways

• benzoate degradation I (aerobic) (1/2 steps found)
• meta cleavage pathway of aromatic compounds (2/10 steps found)
• toluene degradation IV (aerobic) (via catechol) (2/13 steps found)
• mandelate degradation to acetyl-CoA (1/18 steps found)
• superpathway of aerobic toluene degradation (3/30 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (5/35 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (8/42 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Fluorobenzoate degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.12.10

Sequence Analysis Tools

See A0A1I2CB85 at UniProt or InterPro

Protein Sequence (361 amino acids)

>ABZR86_RS00370 aromatic ring-hydroxylating dioxygenase subunit alpha (Dyella japonica UNC79MFTsu3.2)
MTELLSPDVLAPQALDHALALSARFYTHAAAPALDTRAVFARSWQLVGHRAQLAETGDHL
VTQIAGLPLLIVRSDEQTIRAFHNVCRHRAGPIASCDGKGAKALRCRYHGWTYGLDGVLR
GAPEMGRTPDFDPAQIRLPEVRVQVWQGLVFVAVGEAPPFEHFVEGIDQRLGPGRRLSDF
EFHHRVGYDVACNWKVYVDNYLEGYHVPHIHPGLNSLLDYRSYITETAEWYSYQFSPLES
ASDLYGSGEALYYFLYPNAMLNILPGRLQTNRVLPLGVDRCRVEFDFYYAPEPGDAAQAR
RAADIAFSDEVQVEDVTICEDVQRGLASGSYEAGRLNPLRENAVHHFHELLRRAYRESAH
A