Protein Info for ABZR86_RS00305 in Dyella japonica UNC79MFTsu3.2

Annotation: deoxyribonuclease V

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 PF04493: Endonuclease_5" amino acids 27 to 220 (194 residues), 231.7 bits, see alignment E=3.2e-73

Best Hits

Swiss-Prot: 72% identical to NFI_AZOVD: Endonuclease V (nfi) from Azotobacter vinelandii (strain DJ / ATCC BAA-1303)

KEGG orthology group: K05982, deoxyribonuclease V [EC: 3.1.21.7] (inferred from 72% identity to avn:Avin_13030)

MetaCyc: 52% identical to endonuclease V (Escherichia coli K-12 substr. MG1655)
Deoxyribonuclease V. [EC: 3.1.21.7]

Predicted SEED Role

"Endonuclease V (EC 3.1.21.7)" in subsystem DNA repair, bacterial (EC 3.1.21.7)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.21.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2CAE6 at UniProt or InterPro

Protein Sequence (226 amino acids)

>ABZR86_RS00305 deoxyribonuclease V (Dyella japonica UNC79MFTsu3.2)
MDWMTTIADAVPAWDGDVAKARALQSTLAGQVSLVEDFAEPARIAGVDVGFEEQGAITRA
AAVLLDARSLQPLAHALARLPTRMPYIPGLLSFRELPAVLQALAGLPEQPGLVFVDGQGI
AHPRGLGIAAHLGVITGLPTIGVAKTILVGTHAPLGEQRGDSVPLLFKGRAVGTVLRSKP
KVRPLIVSPGHRVSIEGAARRVLAGCTRYRLPEATRWADKLASRRG