Protein Info for ABZR86_RS00155 in Dyella japonica UNC79MFTsu3.2

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 107 to 124 (18 residues), see Phobius details amino acids 144 to 167 (24 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 225 to 248 (24 residues), see Phobius details amino acids 259 to 278 (20 residues), see Phobius details amino acids 285 to 304 (20 residues), see Phobius details amino acids 310 to 333 (24 residues), see Phobius details amino acids 345 to 368 (24 residues), see Phobius details amino acids 374 to 395 (22 residues), see Phobius details PF05977: MFS_3" amino acids 5 to 396 (392 residues), 165 bits, see alignment E=2.4e-52 PF07690: MFS_1" amino acids 19 to 240 (222 residues), 83.7 bits, see alignment E=1.3e-27 amino acids 228 to 400 (173 residues), 47.8 bits, see alignment E=1e-16

Best Hits

KEGG orthology group: None (inferred from 71% identity to bug:BC1001_5341)

Predicted SEED Role

"transporter, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2C7Y7 at UniProt or InterPro

Protein Sequence (428 amino acids)

>ABZR86_RS00155 MFS transporter (Dyella japonica UNC79MFTsu3.2)
MLGAFRSLRSYNYRVWAAGGLVSNVGTWMQRTAQDWLVLTELTQKNATAVGIVMALQFGP
QLVLLPLTGYAADHFDRRKLLFATQGLIGALALGLGLLTLGGWVKLWHVYLFAGLLGAVA
AFDAPARQTFVSELAGEEDLSNAVALNSTSFNAARMIGPAVAGALLASMSAGWVFLINAL
SYVAVLASLCMLKADQLHPRLRPARHRGSLMEGFRYVWHRHDLRAVLLMLFLIGTFGLNF
PIFISAMVVKAFHGEADQYGLLTSLMAAGSVAGALFAAQQARPRLSYLIAAALCFGVGCV
LAAAMPTYVWFGVMLVAVGMAAQTYTTSTNSLVQLSTEPAMRGRVIAIQFAIALGGTPIG
APLVGWVADTLGPRWSLGLGALSGLAAVAVGWRYFVRYRQLRMFVEGGRLRFSVSLTTEA
SRAAAEQP