Protein Info for ABIE53_006543 in Paraburkholderia graminis OAS925

Annotation: drug/metabolite transporter (DMT)-like permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 transmembrane" amino acids 9 to 27 (19 residues), see Phobius details amino acids 33 to 55 (23 residues), see Phobius details amino acids 67 to 87 (21 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 151 to 174 (24 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details amino acids 218 to 240 (23 residues), see Phobius details amino acids 247 to 267 (21 residues), see Phobius details amino acids 274 to 299 (26 residues), see Phobius details PF00892: EamA" amino acids 9 to 140 (132 residues), 47.6 bits, see alignment E=9.9e-17 amino acids 157 to 290 (134 residues), 45.3 bits, see alignment E=5.1e-16

Best Hits

KEGG orthology group: None (inferred from 92% identity to bug:BC1001_5563)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (310 amino acids)

>ABIE53_006543 drug/metabolite transporter (DMT)-like permease (Paraburkholderia graminis OAS925)
MSLTQRQQGAITLAGGGLLMGTLGVFVEEARLGALTLVFFRCLFGFLSLAAYCAWKGYFT
RAHFTRRTLTLALISGVLMVTQWVGFFDAIHRTSIAVATVVFHVQPFWVVLIGAALFNER
LGADRLGWIAAAFGGLVLASGVAATENLQGHASYLIGIGEALAGSVLYASVTLIAKGLGN
LRPHLLTLMQCAVGVVCLPFIAPLVAPFDATHIEPMQWFWIVGMGVLHTGLSYVLIYGAL
PKLTTPIIAVLLFVYPLTAIAVDAIVYGRALSLAQWAGMALIVIASLGVNLGWPLFSLLG
SRGRARRQAE