Protein Info for ABIE53_006515 in Paraburkholderia graminis OAS925

Annotation: uronate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01370: Epimerase
  • amino acids 6 to 164 (159 residues), 69.1 bits, E=1.3e-22
• PF13460: NAD_binding_10
  • amino acids 8 to 112 (105 residues), 31.4 bits, E=5.1e-11
• PF01073: 3Beta_HSD
  • amino acids 44 to 116 (73 residues), 33.1 bits, E=9.4e-12
• PF16363: GDP_Man_Dehyd
  • amino acids 45 to 161 (117 residues), 36.7 bits, E=1e-12
• PF02719: Polysacc_synt_2
  • amino acids 48 to 114 (67 residues), 20.4 bits, E=8e-08
• PF07993: NAD_binding_4
  • amino acids 55 to 188 (134 residues), 22.9 bits, E=1.3e-08

Best Hits

KEGG orthology group: None (inferred from 96% identity to bug:BC1001_5589)

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (11/11 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• D-galactose detoxification (1/3 steps found)
• stachyose degradation (2/7 steps found)
• UDP-sugars interconversion (3/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2

Protein Sequence (285 amino acids)

>ABIE53_006515 uronate dehydrogenase (Paraburkholderia graminis OAS925)
MKKIALSGAGGQLGSVVRAAFIARGTPLRSAAGSKPLTPLIDGEDVMHGDLRDPAVVDRL
LEGVDVLIHFAGTSVERPLPEIIENNLRGLVEVYEGARRHGVKRIVFASSNHAIGMYPVT
ERLSLDCELRPDGFYGLSKVWGEALARMYWDKHGIESVCVRIGSCLERPTEPRHLSTWFG
HADLMHFLDRCIEADDLGFITVWGVSANTRSWWDNSGAARLGYTPKQNAEDYADEILARP
NPLDALGQRFQGGGFVGIDYSRREEEGAGTGAGTGAGSASAARPA