Protein Info for ABIE53_006506 in Paraburkholderia graminis OAS925

Annotation: 5-dehydro-4-deoxyglucarate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 TIGR03249: 5-dehydro-4-deoxyglucarate dehydratase" amino acids 4 to 301 (298 residues), 450.4 bits, see alignment E=1.3e-139 PF00701: DHDPS" amino acids 13 to 301 (289 residues), 179.8 bits, see alignment E=2.7e-57

Best Hits

Swiss-Prot: 76% identical to KDGD_PSEPU: 5-dehydro-4-deoxyglucarate dehydratase from Pseudomonas putida

KEGG orthology group: K01707, 5-dehydro-4-deoxyglucarate dehydratase [EC: 4.2.1.41] (inferred from 98% identity to bug:BC1001_5598)

MetaCyc: 69% identical to 5-dehydro-4-deoxyglucarate dehydratase subunit (Acinetobacter baylyi ADP1)
5-dehydro-4-deoxyglucarate dehydratase. [EC: 4.2.1.41]

Predicted SEED Role

"5-dehydro-4-deoxyglucarate dehydratase (EC 4.2.1.41)" in subsystem D-Galacturonate and D-Glucuronate Utilization or D-galactarate, D-glucarate and D-glycerate catabolism (EC 4.2.1.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.41

Use Curated BLAST to search for 4.2.1.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>ABIE53_006506 5-dehydro-4-deoxyglucarate dehydratase (Paraburkholderia graminis OAS925)
MTTPQELKQIVSEGLLSFPVTDFDAQGEFRADTFAERLEWLAPYGASALFVAGGTGEFFS
LTHNDYSNVVRTAAEVCKGKVPILAGAGGPTRVAIEYAKEAERHGANGILLMPHYLTEAC
QEGIAAHAEEVCKSVPNMGVIIYNRANSKLNADMLEGLAERCPNLIGFKDGVGEIENMVT
IRRRLGDRFSYLGGLPTAEVYAAAYKALGVPVYSSAVFNFIPKTAMDFYRAIAADDHATV
GKLIDEFFLPYLKIRNRRAGYAVSIVKAGAKLVGHSAGPVRAPLTDLTEEEMAQLDALIK
TLGPQ